Entry information : NvePxDo01
Entry ID 7247
Creation 2010-02-23 (Marcel Zamocky)
Last sequence changes 2010-11-16 (Marcel Zamocky)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2010-11-18 (Christophe Dunand)
Peroxidase information: NvePxDo01
Name NvePxDo01
Class Short peroxidockerin     [Orthogroup: PxDo001]*
Taxonomy Eukaryota Metazoa Cnidaria Anthozoa Edwardsiidae Nematostella
Organism Nematostella vectensis    [TaxId: 45351 ]
Cellular localisation N/D
Tissue type Embryos
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value NvePxDo01
start..stop
S start..stop
LspPxDo01 369 2.63e-121 4..482 144..629
PlmaPxDo01 365 3.55e-118 5..478 97..553
BmaPxDo01 360 5.5e-118 4..507 22..500
RbaPxDo02 362 1.25e-116 2..507 198..680
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7247' 'complement(join(830387..830999,831450..831931,832424..832849)) ' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 832424..832849 424 N° 2 831450..831931 480 N° 3 830387..830999 611  
complement(join(830387..830999,831450..831931,832424..832849))


exon

Literature and cross-references NvePxDo01
Literature Putnam N.H., Srivastava M., Hellsten U., Dirks B., Chapman J., Salamov A., Terry A., Shapiro H., Lindquist E., Kapitonov V.V., Jurka J., Genikhovich G., Grigoriev I.V., Lucas S.M., Steele R.E., Finnerty J.R., Technau U., Martindale M.Q., Rokhsar D.S (2007) Sea anemone genome reveals ancestral eumetazoan gene repertoire and genomic organization. Science 317:86-94.
Protein ref. GenBank:   XP_001636873.1 UniProtKB:   A7RUU2
DNA ref. GenBank:   DS469541.1 (832849..830387)
EST ref. GenBank:   FC252309.1 [5' end]  FC239962.1 [3' end]
Cluster/Prediction ref. UniGene:   Nve.18536
Protein sequence: NvePxDo01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   507 (367)
PWM (Da):   %s   57366.88 (40465.7)  
PI (pH):   %s   7.38 (4.67) Peptide Signal:   %s   cut: 27 range:27-393
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
SAQRFPRIDAVGNNVHHPNLGKPMMPLLRLAKPAYADGFEEPSGQARPGPRAISNAIFDQRVDVFSKEGLNEFHMHFGQLVAHDTDFATPYANFLTSENFGIPIPAGDPWFDPHGTGTQM
MRFRRSAKLQTTGKLHGKPREQVNKITAFLDLSFLYGSQAERTQMLRSMKHGKLKHQEGEMITPNTKQVPNLNLLNGPRDKMLVSGDNRVNVQPGLIALHTLWSREHNHICDEIRARTPD
MDDETLFQHARALTRAKWQKIVWEEYLPTVIGSEEFARLGKYQGYNSSIHVGIFNEFSTAAFRFGHSQIGNTMHRLNENWEMAEQGHLSLRDAYFNPGRVIQEGGIEPLIRGMLKQFAQN
VDTKFTDAVRNFLFGTNTMGLDLVSLGIQRGRDHGLADYNAVREAIGLPRRASFAEITPDENTLKKFEVYPSVDDVDLWVGGLAEEHVEGGCVGETFARIIAMQFKVLRDGDRFWYENPD
TMVYNLRDRTRLPTKVVTMNEVLQRTT

Retrieve as FASTA  
Remarks Partial sequence from genomic (2 introns in this part) and 3 ESTs. Peroxidockerin fragment in starlet sea anemone genome, N-terminal part is missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2






CTGTTCTCGAGGTTTCCCGTGTAGCTTTCCTGTCGTCTGCAATTTCGCCGATCTTCTAAAGCGCATCATCTGTGTTCCCGTACCATGCGGGTCAAACCACGGGTCTCCCGCGGGAATCGG
GATCCCAAAGTTCTCCGACGTCAGAAAGTTGGCGTAAGGCGTTGCAAAATCTGTGTCGTGAGCCACCAATTGGCCAAAGTGCATGTGGAACTCGTTAAGACCTTCTTTGCTGAATACATC
CACGCGCTGGTCGAAGATTGCGTTAGATATCGCCCGCGGTCCGGGTCGCGCTTGGCCAGAGGGTTCCTCAAAACCATCTGCGTACGCAGGCTTGGCAAGTCGCAACAGAGGCATCATGGG
TTTGCCAAGGTTAGGGTGATGGACGTTATTGCCGACGGCGTCTATTCGCGGAAATCTCTGGGCGGA

Retrieve as FASTA