Entry information : SmKat01-1_2 (SmKat01a_2)
Entry ID 7279
Creation 2010-03-04 (Christophe Dunand)
Last sequence changes 2011-02-01 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-02-01 (Christophe Dunand)
Peroxidase information: SmKat01-1_2 (SmKat01a_2)
Name (synonym) SmKat01-1_2 (SmKat01a_2)
Class Catalase    [Orthogroup: Kat001]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmKat01-1_2
start..stop
S start..stop
SmKat01-2_44 1008 0 1..492 1..492
AcvKat02 899 0 1..492 1..492
SmKat02-2_1 895 0 1..492 1..492
SmKat02-1_5 895 0 1..492 1..492
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3734072..3734086 15 N° 2 3733793..3733889 97 N° 3 3733436..3733713 278 N° 4 3733237..3733371 135
N° 5 3732519..3733160 642 N° 6 3732384..3732473 90 N° 7 3732252..3732319 68 N° 8 3732095..3732188 94
N° 9 3731978..3732037 60  
complement(join(3731978..3732037,3732095..3732188,3732252..3732319,3732384..3732 473,3732519..3733160 ,3733237..3733371,3733436..3733713,3733793..3733889,3734072 ..3734086))


exon

Literature and cross-references SmKat01-1_2 (SmKat01a_2)
DNA ref. Phytozome 12:   scaffold_2 (3734086..3731978)
mRNA ref. JGI transcript:   438313 [Incorrect prediction]
Protein sequence: SmKat01-1_2 (SmKat01a_2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   492
PWM (Da):   %s   55389.76  
PI (pH):   %s   8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDPYKYRPSSAYNSAHFTTNTGAPVWNNNASLTVGSRGPILLEDYHLVEKLAQFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFVRDGMKFPDMVHALKPNPRTHIQxxxxxxxxFSHHPESLHMFTFLLDDIGIPLNYRHMEGFGVHTFTLVNRAGKCSYVKFHWKPTCGVKSLLEEQAVIVGGSNHSHATQDLQDSIAAGNYPEWKLFIQTMEIKNENNYDFDPLDVTKTWPEDLFPLQPVGRLVLNKNIDNFFAENEQLAFCPALVVPGVYYTDDKLLQTRIFSYADTQRHRLGPNYLLLPANAPKCAHHNNHHEGFMNFTHRDEEVNYFPSRFDPCRHAERVPIPSHPLGGRREKVMIEKENNFAQPGARFRSWPADRQERFIARVVDALSDPRVTHEIRSIWLSYWSQADRMLGQKIATKLNVKANM

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATCCCTATAAGGTTTGATTCTCACCTTTTGTGCCGTAGCAGCTAGCGTAGAGTAGCTTATTGATTCTTTGCGCATTGCGGTGCCGGATCAATCTAGAGCAGTTTCTTCGCAATCGT
GGTCTAGGCCTCGCCATTTCTTGATCTTCTTGCTCGATTTCTTCACGATTTGACAAAATTTCCTTGGATTTCTCCAGTATCGCCCTTCCAGCGCCTATAATTCGGCCCATTTCACCACGA
ACACTGGCGCTCCTGTGTGGAACAACAATGCGTCGCTCACCGTGGGCTCTCGAG
GTACACAATTTCTTTCTATCCATAGCCCAAAATACTTACTTCATTGTATCTTTATTTTTTGTTTTT
TTTTTCTTGCCAGGTCCTATCCTTCTCGAGGATTATCATCTGGTCGAGAAGCTGGCCCAGTTTGATCGTGAAAGAATTCCCGAGCGTGTCGTGCATGCACGAGGAGCGAGTGCCAAGGGA
TTTTTCGAGGTGACCCACGACGTATCCCACCTCACTTGTGCCGATTTCCTGAGAGCTCCCGGAGTGCAAACTCCCGTTATCGTGCGGTTCTCTACTGTCATTCACGAGCGTGGCAGCCCA
GAAACTCTTCGAGATCCTCGAGGCTTTGCGGTCAAGTTCTACACTCGAGAG
GTTTGTAGTCTTTTTGTTTTGCTTTCTTTCGTTTTTCTCAAAGAATGTTGTGTTGTGGATGCAGGGAAA
CTTTGATATGGTTGGAAACAATTTTCCCGTGTTCTTCGTCCGGGATGGAATGAAGTTCCCTGACATGGTCCATGCGCTGAAGCCCAACCCAAGGACTCATATCCAGNNNNNNNNNNNNNN
NNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTCTCGCACCATCCCGAGAGTCTTCACATGTTCA
CGTTCCTGCTCGACGATATTGGCATCCCGCTCAACTATCGTCATATGGAGGGCTTTGGCGTCCACACTTTCACCCTCGTGAACCGGGCTGGCAAGTGCTCCTACGTGAAGTTCCACTGGA
AGCCAACTTGTGGTGTCAAGAGCTTGCTGGAAGAACAGGCAGTCATCGTTGGTGGATCGAACCACAGCCATGCAACGCAGGATCTGCAAGACTCTATTGCAGCAGGGAACTATCCCGAGT
GGAAGCTGTTTATCCAGACCATGGAAATCAAGAACGAGAACAACTACGACTTCGATCCTTTGGATGTTACCAAGACGTGGCCCGAGGATCTCTTCCCGCTGCAGCCCGTGGGTCGGCTAG
TTTTAAACAAGAACATCGACAACTTCTTTGCGGAGAACGAGCAGCTGGCTTTCTGCCCCGCTTTGGTGGTGCCTGGAGTTTATTACACGGACGACAAGCTGCTTCAGACCCGAATTTTCT
CGTACGCTGACACTCAGAGGCACAGGCTGGGGCCGAATTACTTGCTGCTTCCTGCGAACGCTCCCAAGTGTGCTCATCACAACAACCATCACGAGGGATTCATGAACTTCACCCACAGGG
ACGAAGAG
GTATGACAAGCTTTTGCTTATACGTTCTATATCCTGTGTTTGCAGGTGAACTATTTCCCTTCGCGTTTTGATCCTTGCCGTCACGCTGAGCGAGTGCCTATTCCTTCTCACC
CTCTCGGTGGTCGACGAGAAAAG
GTTTGGCTAGTCTAACTTTCATCTTCTCATTTTATGCTTTGGCAATAATGTTTTTCTCTTGTAGGTGATGATTGAAAAGGAAAATAACTTTGCTCAG
CCAGGAGCAAGGTTCCGCTCCTGGCCTGCTGACAG
GCAAGATCTCAAACCTCTCTCTCAGCTAGTCATGTTTTAACTGAATCTCTGCTCCTCTTCCAGGCAAGAGCGTTTCATTGCGAGA
GTTGTGGATGCTCTGTCCGACCCGCGCGTCACCCACGAAATCCGTAGCATCTGGCTCTCTTACTGGTCTCAG
GTTAGACAAGAAAGAAAAGACAGCATGTGATCAAACTCAACCATGAAA
CGTGTGCAGGCGGATCGTATGCTTGGTCAGAAGATTGCAACAAAACTCAACGTGAAAGCCAACATGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATCCCTATAAGTATCGCCCTTCCAGCGCCTATAATTCGGCCCATTTCACCACGAACACTGGCGCTCCTGTGTGGAACAACAATGCGTCGCTCACCGTGGGCTCTCGAGGTCCTATC
CTTCTCGAGGATTATCATCTGGTCGAGAAGCTGGCCCAGTTTGATCGTGAAAGAATTCCCGAGCGTGTCGTGCATGCACGAGGAGCGAGTGCCAAGGGATTTTTCGAGGTGACCCACGAC
GTATCCCACCTCACTTGTGCCGATTTCCTGAGAGCTCCCGGAGTGCAAACTCCCGTTATCGTGCGGTTCTCTACTGTCATTCACGAGCGTGGCAGCCCAGAAACTCTTCGAGATCCTCGA
GGCTTTGCGGTCAAGTTCTACACTCGAGAG
GGAAACTTTGATATGGTTGGAAACAATTTTCCCGTGTTCTTCGTCCGGGATGGAATGAAGTTCCCTGACATGGTCCATGCGCTGAAGCCC
AACCCAAGGACTCATATCCAGNNNNNNNNNNNNNNNNNNNNNNNN
TTCTCGCACCATCCCGAGAGTCTTCACATGTTCACGTTCCTGCTCGACGATATTGGCATCCCGCTCAACTATCGT
CATATGGAGGGCTTTGGCGTCCACACTTTCACCCTCGTGAACCGGGCTGGCAAGTGCTCCTACGTGAAGTTCCACTGGAAGCCAACTTGTGGTGTCAAGAGCTTGCTGGAAGAACAGGCA
GTCATCGTTGGTGGATCGAACCACAGCCATGCAACGCAGGATCTGCAAGACTCTATTGCAGCAGGGAACTATCCCGAGTGGAAGCTGTTTATCCAGACCATGGAAATCAAGAACGAGAAC
AACTACGACTTCGATCCTTTGGATGTTACCAAGACGTGGCCCGAGGATCTCTTCCCGCTGCAGCCCGTGGGTCGGCTAGTTTTAAACAAGAACATCGACAACTTCTTTGCGGAGAACGAG
CAGCTGGCTTTCTGCCCCGCTTTGGTGGTGCCTGGAGTTTATTACACGGACGACAAGCTGCTTCAGACCCGAATTTTCTCGTACGCTGACACTCAGAGGCACAGGCTGGGGCCGAATTAC
TTGCTGCTTCCTGCGAACGCTCCCAAGTGTGCTCATCACAACAACCATCACGAGGGATTCATGAACTTCACCCACAGGGACGAAGAG
GTGAACTATTTCCCTTCGCGTTTTGATCCTTGC
CGTCACGCTGAGCGAGTGCCTATTCCTTCTCACCCTCTCGGTGGTCGACGAGAAAAG
GTGATGATTGAAAAGGAAAATAACTTTGCTCAGCCAGGAGCAAGGTTCCGCTCCTGGCCTGCT
GACAG
GCAAGAGCGTTTCATTGCGAGAGTTGTGGATGCTCTGTCCGACCCGCGCGTCACCCACGAAATCCGTAGCATCTGGCTCTCTTACTGGTCTCAGGCGGATCGTATGCTTGGTCAG
AAGATTGCAACAAAACTCAACGTGAAAGCCAACATGTAA

Retrieve as FASTA