Entry information : GmPrx92 (Glyma11g29920.1)
Entry ID 7283
Creation 2010-03-10 (Christophe Dunand)
Last sequence changes 2011-07-04 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx92 (Glyma11g29920.1)
Name (synonym) GmPrx92 (Glyma11g29920.1)
Class Class III peroxidase    [Orthogroup: Prx039]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx92
start..stop
S start..stop
GmPrx70 603 0 1..323 1..325
GmPrx120 523 0 8..323 6..323
GmPrx62 523 0 1..323 33..359
GmPrx13 516 0 1..323 1..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 30827482..30827697 216 N° 2 30825273..30825467 195 N° 3 30823691..30824251 561  
complement(join(30823691..30824251,30825273..30825467,30827482..30827697))


exon

Literature and cross-references GmPrx92 (Glyma11g29920.1)
Literature Cheung F., Xiao Y., Chan A., Moskal W., Town C.D. (unpublished since 2009).
Protein ref. UniProtKB:   C6TH58
DNA ref. Phytozome 12:   Gm11 (30827697..30823691)
mRNA ref. GenBank:   BT096974
EST ref. GenBank:   EV281455.1 [5' end]
Protein sequence: GmPrx92 (Glyma11g29920.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (299)
PWM (Da):   %s   35727.66 (32988.2) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.89 (9.89) Peptide Signal:   %s   cut: 26 range:26-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASNIQTLLVLVLATLAIFMIPSNAQLTPNFYKKVCPQALPIIRSVVHREIIRERRIGASLLRLHFHDCFVNGCDGSVLLDDTRNFTGEKTALPNLNSIRGLEVVDEIKEAVDKACKRPVVSCADILATAARDSVAILGGPHLRYSVLLGRRDARTASKDAANANLPPPFFSFSQLLSNFKFHGLDLKDLVALSGGHTLGFARCTTFRDRIYNDTNINPTFAASLRKTCPRVGAGNNLAPLDPTPATVDTSYFKELLCKKGLLHSDQELYKGNGSESDKLVELYSRNPFAFARDFKASMIKMGNMKPLTGNKGEIRRNCRRVNN*

Retrieve as FASTA  
Remarks Complete sequence from genomic, 1 mRNA and 1 EST. Unigen compiles ESTs from two genes.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTAATATCCAAACTCTGCTTGTGCTTGTTCTGGCTACATTGGCCATATTTATGATCCCTTCCAATGCACAACTTACTCCTAATTTCTATAAGAAAGTTTGTCCCCAAGCATTG
CCAATCATAAGGTCTGTCGTTCACCGTGAAATCATTCGTGAACGACGCATTGGAGCCTCCTTGCTACGTTTGCATTTCCATGACTGCTTTGTTAAT
GTAAGTTATTAGTGTGTGAATTGG
TATATATATACTGTCTTTTATACACATACATTCTTTTATACCATAAATTTAGGCACAACTAAGTAATATTATTTGTAGTATAGTTTCCTATATTACTTTTCTAAAATCAAAATTAAAAAC
TAATTTATTACTATATGCATGGCCAATTAAAGTTTCCTATATCAATTTATATGCAAGGTTTCAATAAATTAAAGTTTTTCGGTTCTGCTAACCAAAACCACGTTATTAATTATGCGCAGC
ATGTAGCTTTTGCCTCTATGTCACTTTTCAGGTGTAAGAATAGATTTGTTAGTTTGACCTTAGGTCATATATAGGGCCAACCCACTTGCCCCCTACAATGACCCTAAGTTTTCTAGCCCA
CTTAACGAAAGGGCCAAAAAAAGCCCTAACCCACAATGTCCTATTTTGTAAAGGGCAAATTATAACAATTTTAAAAATATTTTTCAGTCGATCAATGTTAGATTACTTTTGGATTGGCCT
AAGTCATCTTTTAGTTAGTCTCGATTCGGAAACTTTTCGGCTAACCTCAACCAAAACATTTTTTTTATCAACCACGGCCTAGGTTTCTTTCGGCCAGCCTCGACTAAGACATTTTTTGGT
CATGACTTTTTTCCATTAGCCTTGGCCACGAGACATCTTTCGCCCAGGACAACTTTTGGCTAACATGGCTAGAACAATTTTCAGTTGGTCTTGGCTTGAGCTTCTTTTGGCCAGCCTCAT
CATGATATCTTTTGGCCATGACAATTTTTAGCCAATCATGGCTAAGAATATCTCTAATAAATTTTCTTAGGAAGCTTTTTTTAGATGATGAGGTTTTGTTAAACTTAAAGAACTAATTCT
CATACAATTTCATTATAGGAGTGACAATTCTTGTATGAGAATTGTTGTTTATATAAAGAACTATTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAT
ATAAAGAACTATTCTTAAAAATTGTGAGTCCAATTATATTATATGATGGGTTATCTTAAGTTCTTAAGAACAATACTATTGGAGAAAATAATTATTGAAGTTCTTAAATCTCATGTAACG
TTGTAGAGTTCACCAAAAGTGAGTTAAGTGATTTCATATCATAGATTCATAGTTACACTATTGGAGATGTTCTAAAAGCTAAAATTCCTTCCTTCCATTTTTTTACAGTCAAAGCGTAAT
TTTATAACAAAAAAGAAAAGTTAAGCACATCTTAATTTGTATGATAAATTATTTTAACTCTAAAAATTACCATTAATATATTATCATCAAATTTTTAAAATTAATTTATTTTTAATATAA
TCCGAAAAATTTATACTCTTATTGTAATTTGATCATTTGACTTGAAATTAAGCGTGCATTATTACAATAGCTTTTAAAATAGGTCGCTTAAGTCCATGAAATGATCACTGTATTTGATAC
CTATAAAGAAAAAAAATATAGAAAAAAAGAAGTGTAGATATATAATTGAGATATAGGTGACTAGGTGATATGAAGTGAAAATAGAAACTGTTATTGAAATATTTATAATGAATGAGTATT
TATGTATCTTTATTTATTTATAATTAAATTAAATTTCAATTTTCAGTGATGAATATACGATTAAACCAAAATGATTGTGAATCTTACGTGTTGCAAAGTGATGAACTTGCAGGAAGCTGG
AATACGTAGCAGCCCAACCAATCATGTCGATCATAAAATGAAATAATCTAAACACCATAAATTAAGAAATAACGGAAACATGCATCAAACAGACAGGAACATGCATGTCACTTTCTATTA
GATAACATTATCAAATTTTTGTAATATATTCTAATTAATTTAGTGATTTGTTGGATCATTGGGAGCACAGGGTTGTGATGGATCAGTTCTGCTGGATGATACGCGCAACTTCACTGGCGA
GAAAACAGCCCTACCTAATCTGAATTCAATAAGAGGTTTGGAAGTGGTTGATGAGATTAAGGAAGCTGTTGACAAAGCTTGCAAACGCCCTGTGGTATCATGTGCTGATATCTTAGCTAC
AGCTGCTCGTGATTCTGTGGCCATA
GTAAGTATTAATTATATATAATTATTATACAAACTTTTCGTTCCAGCTAGCAATATTGCACTTAATTTGTTGGGATAAAATCTTAAATTAATTTA
TTTATATTCTTAAGTTAAAATACTCTCGTTACACGAAAACATTATTCATGGAATAAAAACAGTAATGATACATACACGTCATCCTATTATTACAAGGGAAATTATTTTGATTGAACCCCC
GATGCCTGTAGATGAGAAATTATTACAGGATAGGATCATAAACACGTGGTGATTTGTAACTATGTAATATTTTTTTGGTATAAATATTTAGAGACATGAGAAGAAATGATAGATAAGTAA
TGAGAAGAAATGATAAATAAATAATTGATATGATTTGACAAAATAAAGAATAAAGAGAGACATGTGATTTTCAATGGAGCGTTTGCAAGCCACTTTTCAGTGTAAAAAAATGAGGACTCT
TATTACATTCTGTTGCTACAAATAGGCATTAATTTGATACCTCTTATTTCTTAATTTGTTTGTTTATCACATCACACTTCTTATTATAGCTATCACAAATATGTATGTATTGTGTCCGCA
AACATTGCTAATAAAATCAGAATTTAGAGTGATATTTTTTTAGATACTTAAATATTTAAATAAATTTTTCTTTATTTCTCTTATCCCGTCACATCATATTATTTATGATACCTAACTATT
CTTTCTTCTTCTTTTCCTTTTCCCTCTCACAAGCCGTTAAATAACATTTCGGTTGTGCATGTAAAATTCATTTTTGTTTTGTTTAGTTTAGTTTAGAATATTGTTTTTTAGATACTCCAA
TTTTTAAATAGCCCATCAATACTTTTTATTTTTCTTTTCCTGTGATGTCATATTACTTATTTTACCTATACTTTTTTTTTTTTCATTCTCACTATGGATTAAATAACGTTTCGGGTGTGC
GTGTAAAAATCATTTTTGTTTAGTTTATTCTCTAATTTCTTAAGGGGAAGCCTAACCATATCATATTGTCTTTCTGTTAACAACAGTTAGGTGGTCCACACCTACGGTACTCAGTATTAC
TAGGCAGAAGAGACGCAAGAACCGCAAGCAAGGATGCTGCAAACGCCAATCTCCCTCCTCCATTTTTCAGCTTCTCACAACTTCTCTCCAACTTCAAGTTTCACGGATTAGACCTCAAAG
ACTTGGTGGCACTTTCTGGAGGCCACACATTAGGGTTTGCAAGGTGCACTACCTTCAGAGACCGCATCTACAACGACACCAACATAAATCCTACCTTTGCAGCCTCTTTGCGCAAAACAT
GCCCTAGAGTTGGCGCTGGCAACAACTTGGCACCGTTGGATCCAACTCCTGCAACGGTTGACACTTCTTACTTCAAAGAATTGCTGTGCAAAAAGGGTCTTCTTCACTCTGATCAAGAAC
TCTACAAGGGAAATGGCAGTGAAAGTGACAAGTTGGTGGAGCTTTATAGCAGAAACCCTTTTGCATTTGCTAGAGATTTCAAGGCTTCTATGATCAAGATGGGTAACATGAAGCCTCTCA
CTGGGAACAAGGGAGAGATCAGACGCAACTGCAGAAGGGTTAATAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTAATATCCAAACTCTGCTTGTGCTTGTTCTGGCTACATTGGCCATATTTATGATCCCTTCCAATGCACAACTTACTCCTAATTTCTATAAGAAAGTTTGTCCCCAAGCATTG
CCAATCATAAGGTCTGTCGTTCACCGTGAAATCATTCGTGAACGACGCATTGGAGCCTCCTTGCTACGTTTGCATTTCCATGACTGCTTTGTTAAT
GGTTGTGATGGATCAGTTCTGCTG
GATGATACGCGCAACTTCACTGGCGAGAAAACAGCCCTACCTAATCTGAATTCAATAAGAGGTTTGGAAGTGGTTGATGAGATTAAGGAAGCTGTTGACAAAGCTTGCAAACGCCCTGTG
GTATCATGTGCTGATATCTTAGCTACAGCTGCTCGTGATTCTGTGGCCATA
TTAGGTGGTCCACACCTACGGTACTCAGTATTACTAGGCAGAAGAGACGCAAGAACCGCAAGCAAGGAT
GCTGCAAACGCCAATCTCCCTCCTCCATTTTTCAGCTTCTCACAACTTCTCTCCAACTTCAAGTTTCACGGATTAGACCTCAAAGACTTGGTGGCACTTTCTGGAGGCCACACATTAGGG
TTTGCAAGGTGCACTACCTTCAGAGACCGCATCTACAACGACACCAACATAAATCCTACCTTTGCAGCCTCTTTGCGCAAAACATGCCCTAGAGTTGGCGCTGGCAACAACTTGGCACCG
TTGGATCCAACTCCTGCAACGGTTGACACTTCTTACTTCAAAGAATTGCTGTGCAAAAAGGGTCTTCTTCACTCTGATCAAGAACTCTACAAGGGAAATGGCAGTGAAAGTGACAAGTTG
GTGGAGCTTTATAGCAGAAACCCTTTTGCATTTGCTAGAGATTTCAAGGCTTCTATGATCAAGATGGGTAACATGAAGCCTCTCACTGGGAACAAGGGAGAGATCAGACGCAACTGCAGA
AGGGTTAATAAT

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAACTATGCA AAAAGCAGGG TAATAGCACA ACAAGATGGC TTCTAATATC CAAACTCTGC TTGTGCTTGC TCTGGCTACA TTGGCCATAT TTATGATCCC TTCCAATGCA CAACTTACTC  CTAATTTCTA TAAGAAAGTT TGTCCCCAAG CATTGCCAAT CATAAGGTCT GTCGTTCACC GTGAAATCAT TCGTGAACGA CGCATTGGAG CCTCCTTGCT ACGTTTGCAT TTCCATGACT  GCTTTGTTAA TGGTTGTGAT GGATCAGTTC TGCTGGATGA TACGCGCAAC TTCACTGGCG AGAAAACAGC CCTACCTAAT CTGAATTCAA TAAGAGGTTT GGAAGTGGTT GATGAGATTA  AGGAAGCTGT TGACAAAGCT TGCAAACGCC CTGTGGTATC ATGTGCTGAT ATCTTAGCTA CAGCTGCTCG TGATTCTGTG GCCATATTAG GTGGTCCACA CCTACGGTAC TCAGTATTAC  TAGGCAGAAG AGACGCAAGA ACCGCAAGCA AGGATGCTGC AAACGCCAAT CTCCCTCCTC CATTTTTCAG CTTCTCACAA CTTCTCTCCA ACTTCAAGTT TCACGGATTA GACCTCAAAG  ACTTGGTGGC ACTTTCTGGA GGCCACACAT TAGGGTTTGC AAGGTGCACT ACCTTCAGAG ACCGCATCTA CAACGACACC AACATAAATC CTACCTTTGC AGCCTCTTTG CGCAAAACAT  GCCCTAGAGT TGGCGCTGGC AACAACTTGG CACCGTTGGA TCCAACTCCT GCAACGGTTG ACACTTCTTA CTTCAAAGAA TTGCTGTGCA AAAAGGGTCT TCTTCACTCT GATCAAGAAC  TCTACAAGGG AAATGGCAGT GAAAGTGACA AGTTGGTGGA GCTTTATAGC AGAAACCCTT TTGCATTTGC TAGAGATTTC AAGGCTTCTA TGATCAAGAT GGGTAACATG AAGCCTCTCA  CTGGGAACAA GGGAGAGATC AGACGCAACT GCAGAAGGGT TAATAATTAA TGTTGTTGTT GTCGCATTTT ACTGGGATGG ACCACAATAA AGATTGAAAG ATTAAGAAAT TATTGTTATT  ATTATTATTA TTATTATTAT ATGTCAAGTG AATCAAGCCA TGCATGCCAT GTAATGTTTT TTAACTGTAT GTGATTGTGG TATTAATTTA TATTTTCTAT TACCAAAAAA AAAAAAAAAA 

Retrieve as FASTA