Entry information : PEchKat01 (PechrKatE)
Entry ID 7288
Creation 2010-04-09 (Marcel Zamocky)
Last sequence changes 2011-05-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-09-06 (Catherine Mathe (Scipio))
Peroxidase information: PEchKat01 (PechrKatE)
Name (synonym) PEchKat01 (PechrKatE)
Class Catalase    [Orthogroup: Kat001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Penicillium
Organism Penicillium chrysogenum    [TaxId: 5076 ]
Cellular localisation Peroxisomal
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PEchKat01
start..stop
S start..stop
AclKat03 899 0 8..490 12..494
TstKat01 809 0 1..490 1..491
CnKat04_grubiiH99 540 0 5..481 7..488
NcKat04 540 0 5..480 8..480
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 411337..411367 31 N° 2 411418..411547 130 N° 3 411607..411841 235 N° 4 411890..411982 93
N° 5 412032..412451 420 N° 6 412502..412586 85 N° 7 412648..413126 479  
join(411337..411367,411418..411547,411607..411841,411890..411982,412032..412451, 412502..412586,412648..413126)


exon

Literature and cross-references PEchKat01 (PechrKatE)
Literature REFERENCE 1 Kiel J.A.K.W, van den Berg M.A., Fusetti F., Poolman B., Bovenberg R.A.L., Veenhuis M., van der Klei I.J. (2009). Matching the proteome to the genome: the microbody of penicillin-producing Penicillium chrysogenum cells. Funct Integr Genomics 9:167-184
REFERENCE 2 van den Berg M.A., Albang R., Albermann K., Badger J.H., Daran J.-M., Driessen A.J.M., Garcia-Estrada C., Fedorova N.D., Harris D.M., Heijne W.H.M., Joardar V.S., Kiel J.A.K.W., Kovalchuk A., Martin J.F., Nierman W.C., Nijland J.G., Pronk J.T., Roubos J.A. , van der Klei I.J., van Peij N.N.M.E., Veenhuis M., von Doehren H., Wagner C., Wortman J.R., Bovenberg R.A.L.(2008)Genome sequencing and analysis of the filamentous fungus Penicillium chrysogenum. Nat. Biotechnol. 26:1161-1168(2008).
Protein ref. UniProtKB:   B6H7V0
DNA ref. JGI genome:   scaffold_4 (411337..413126)
Protein sequence: PEchKat01 (PechrKatE)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336
PWM (Da):   %s   35993.87  
PI (pH):   %s   4.43
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSNRTFTLAEGQPVADPSVSTTLPTFGGGGLTTLGDTLLIEVLSHFNRERIPERVVHAKAAGAWGEFEVTNDISSLTSAKFLNGVGKKTPILFRLSTTGGEKGSADTVRDVRGFSVKFFTEEGNHDIVGNHPVFFVRDPVRFPSLNRSHKRHPATNRPDWTMFWDFHANQPESVHALMHLFGTRGIPDSIRRVTGFGVHTFKMVSADGGFRYCKFHFRPTQNTTHFSDQEATRMAGANADFHTQDLWDAIARGDLPVWKLYVQIMEPEQAETYGRALFDITKVWPHKDFPLIEVGQMTLNKNPENYFAEIEQAAFSPSNMVPGIAMTPDPMLQARMFAYPDAQRYRLGVNYTQLPPNRAICPIYAPFERDGMGTMTRNYGGDPNYVRSSLGTGVPSQIVSNVRHTERIERNAILGQNEIPVDDEDFLQPRELWNRVFDECERRKWVANVSETLEDVPDQLRDAVATMFSKVDPRIGQLLDAKAKNSSRL

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns). No EST available. Strain="ATCC 28089 / DSM 1075 / Wisconsin 54-1255".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAAATCGTACTTTTACATTGGCGGAAGGTATGGTTCCAGTCATGCCAATCGAGTGTTCCCATTCTGACACCAGGCAGGCCAACCAGTTGCAGACCCATCCGTCAGCACCACCTTGC
CTACCTTTGGCGGTGGCGGCCTCACGACGCTGGGTGACACACTTCTTATTGAGGTACTTTCGCACTTCAACCGCGAACGTATCCCGGAAAG
GTCTGAGATCATTGGACCTGATTCTTTTT
GGAAGGAAAGGATATCCTAACGCTGAACAGAGTCGTCCATGCTAAGGCTGCGGGTGCCTGGGGAGAATTCGAGGTTACAAACGATATTTCCTCCCTGACGTCAGCCAAGTTCCTCAATGG
TGTTGGGAAGAAAACGCCTATTTTATTCCGTCTGAGCACTACTGGCGGTGAGAAGGGTAGCGCAGACACCGTCCGCGATGTGCGAGGCTTTTCTGTCAAATTCTTCACGGAGGAAGGCAA
TCACGATATTGTAGGGAACCATATT
GTAAGTGTTCACTCTTGATTTCCAAGATTGTATTCTAACTTCGCCAAGCCGGTGTTTTTCGTTCGTGACCCTGTCAGGTTTCCTTCTCTCAACAG
AAGCCATAAGAGACATCCTGCCACCAACCGCCCGGACTGGACGATG
GTGAGAGCTAATCAGAACATTATCCTATCCGATAAAGCTGACCATTTAGTTTTGGGATTTCCACGCAAACCAGC
CAGAAAGTGTCCATGCTTTGATGCACCTTTTTGGCACCCGTGGTATTCCTGATTCGATCCGTCGAGTGACAGGGTTCGGTGTACATACCTTCAAAATGGTGTCAGCCGATGGTGGCTTCC
GCTACTGCAAGTTCCACTTCCGGCCGACCCAGAATACAACACACTTCTCTGACCAGGAAGCTACTCGCATGGCTGGTGCAAACGCCGACTTCCACACTCAGGATCTGTGGGACGCTATTG
CTCGGGGAGACTTGCCTGTCTGGAAGCTCTACGTACAGATCATGGAGCCCGAGCAGGCTGAAACCTACGGCCGTGCCTTGTTTGACATCACCAAAGTTTGGCCTCACAAGGACTTCCCCT
TGATTGAAGTTGGTCAAATGACTCTCAACAAAAAT
GTGGGTGGCTCCTTATCCTAGACACGAAGCAAGTGTTAACAACAGCGCAGCCCGAGAACTATTTTGCCGAAATCGAGCAAGCAGC
ATTTTCGCCTTCTAACATGGTGCCTGGGATCGCAATGACGCCTGACCCTA
GTAAGTCTACACTGATGTCGTCATCCGACGGGTCAGAATGCTAACAATTCTGTCTATACAGTGTTGCAGG
CGCGCATGTTCGCTTATCCTGACGCCCAACGATACCGCCTAGGTGTTAACTACACACAGCTTCCACCAAACCGTGCCATCTGCCCTATATACGCTCCATTCGAACGTGACGGCATGGGAA
CTATGACCCGAAACTACGGTGGCGACCCGAACTATGTACGGAGTTCACTGGGTACAGGTGTTCCTAGCCAAATTGTTTCTAATGTACGACACACCGAACGCATCGAGCGGAACGCTATTC
TCGGCCAGAATGAGATTCCGGTGGATGACGAGGACTTTCTTCAGCCACGAGAGCTGTGGAACAGGGTCTTTGATGAGTGCGAGAGAAGGAAGTGGGTCGCCAATGTGTCGGAGACTCTGG
AAGACGTGCCTGATCAGCTCAGGGATGCTGTCGCTACCATGTTCAGCAAGGTGGATCCCCGCATTGGCCAATTGTTAGACGCTAAGGCCAAGAACAGTTCGCGTCTCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAAATCGTACTTTTACATTGGCGGAAGGCCAACCAGTTGCAGACCCATCCGTCAGCACCACCTTGCCTACCTTTGGCGGTGGCGGCCTCACGACGCTGGGTGACACACTTCTTATT
GAGGTACTTTCGCACTTCAACCGCGAACGTATCCCGGAAAG
AGTCGTCCATGCTAAGGCTGCGGGTGCCTGGGGAGAATTCGAGGTTACAAACGATATTTCCTCCCTGACGTCAGCCAAG
TTCCTCAATGGTGTTGGGAAGAAAACGCCTATTTTATTCCGTCTGAGCACTACTGGCGGTGAGAAGGGTAGCGCAGACACCGTCCGCGATGTGCGAGGCTTTTCTGTCAAATTCTTCACG
GAGGAAGGCAATCACGATATTGTAGGGAACCATATT
CCGGTGTTTTTCGTTCGTGACCCTGTCAGGTTTCCTTCTCTCAACAGAAGCCATAAGAGACATCCTGCCACCAACCGCCCGGAC
TGGACGATG
TTTTGGGATTTCCACGCAAACCAGCCAGAAAGTGTCCATGCTTTGATGCACCTTTTTGGCACCCGTGGTATTCCTGATTCGATCCGTCGAGTGACAGGGTTCGGTGTACAT
ACCTTCAAAATGGTGTCAGCCGATGGTGGCTTCCGCTACTGCAAGTTCCACTTCCGGCCGACCCAGAATACAACACACTTCTCTGACCAGGAAGCTACTCGCATGGCTGGTGCAAACGCC
GACTTCCACACTCAGGATCTGTGGGACGCTATTGCTCGGGGAGACTTGCCTGTCTGGAAGCTCTACGTACAGATCATGGAGCCCGAGCAGGCTGAAACCTACGGCCGTGCCTTGTTTGAC
ATCACCAAAGTTTGGCCTCACAAGGACTTCCCCTTGATTGAAGTTGGTCAAATGACTCTCAACAAAAAT
CCCGAGAACTATTTTGCCGAAATCGAGCAAGCAGCATTTTCGCCTTCTAAC
ATGGTGCCTGGGATCGCAATGACGCCTGACCCTA
TGTTGCAGGCGCGCATGTTCGCTTATCCTGACGCCCAACGATACCGCCTAGGTGTTAACTACACACAGCTTCCACCAAACCGTGCC
ATCTGCCCTATATACGCTCCATTCGAACGTGACGGCATGGGAACTATGACCCGAAACTACGGTGGCGACCCGAACTATGTACGGAGTTCACTGGGTACAGGTGTTCCTAGCCAAATTGTT
TCTAATGTACGACACACCGAACGCATCGAGCGGAACGCTATTCTCGGCCAGAATGAGATTCCGGTGGATGACGAGGACTTTCTTCAGCCACGAGAGCTGTGGAACAGGGTCTTTGATGAG
TGCGAGAGAAGGAAGTGGGTCGCCAATGTGTCGGAGACTCTGGAAGACGTGCCTGATCAGCTCAGGGATGCTGTCGCTACCATGTTCAGCAAGGTGGATCCCCGCATTGGCCAATTGTTA
GACGCTAAGGCCAAGAACAGTTCGCGTCTCTAG

Retrieve as FASTA