Entry information : ZmPrx33(Zm00001d010409 / GRMZM2G150134)
Entry ID 729
Creation 2005-12-15 (Christophe Dunand)
Last sequence changes 2005-12-15 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2023-01-02 (Christophe Dunand)
Peroxidase information: ZmPrx33(Zm00001d010409 / GRMZM2G150134)
Name ZmPrx33(Zm00001d010409 / GRMZM2G150134)
Class Class III peroxidase    [Orthogroup: Prx037]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Endosperm
Mixed tissues
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx33
start..stop
S start..stop
SbPrx117 587 0 26..360 5..338
OsPrx73 365 1.1e-126 64..360 10..308
AtrPrx19 313 2.07e-106 62..359 6..303
GmPrx166 305 4.69e-103 64..359 29..327
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '729' 'join(110686785..110687111,110687215..110687578,110687681..110688072)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 110686785..110687111 325 N° 2 110687215..110687578 362 N° 3 110687681..110688072 390  
join(110686785..110687111,110687215..110687578,110687681..110688072)


exon

Literature and cross-references ZmPrx33(Zm00001d010409 / GRMZM2G150134)
Literature Walbot,V., unpublished
DNA ref. GenBank:   AC196291 (123316..124534)
Cluster/Prediction ref. UniGene:   Zm.19338
Protein sequence: ZmPrx33(Zm00001d010409 / GRMZM2G150134)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   360
PWM (Da):   %s   38272.49 Transmb domain:   %s   i9-31o
PI (pH):   %s   7.12
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLSSSLPSRRHHSSRVVDRSQEMGASGGEKLGTLVCVLAHVSLLLVLVLAPCVCKATGGDYGGLSNDHYTESCPELETIVKKSLAPIFAVDITSPAALLRLLFHDCQVHGCDGSILLNSD
ERRHITSELGSRKNLGIRHVGTVGLVKAAVEAACPGRVSCADIVVLAAREAVAHTGGPRVASVPLGRRDATTTSTQAADAQLPSCFLGIDGALDIFTSRGMTVEETVAILGSHTLGGGHC
VNIDTGRARRDKAFEALLHLQCPKTMPPLITEAVVFVPSDLTPTWFDTHYYRGAAAGRGLFNVDDEASTYARTAGYVRRFAEDREGFFGVFASAFVKLSGFGVLTGEQGEIRKKCDVVNY
*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 8, intron 1 and 3) and 92 ESTs. Also found in AC201782.4
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGTCTTCCTCACTTCCATCCAGACGTCATCATTCCTCTCGAGTAGTCGATCGGAGTCAGGAGATGGGCGCGTCTGGTGGTGAAAAGCTTGGTACTCTTGTGTGTGTTCTTGCACAT
GTATCGTTATTATTGGTGCTCGTGCTAGCACCGTGTGTGTGCAAGGCGACTGGTGGTGACTACGGCGGCCTCTCCAACGACCACTACACCGAGTCCTGCCCGGAGCTGGAGACCATCGTC
AAGAAGTCCCTGGCGCCGATCTTCGCCGTGGACATCACCTCGCCGGCCGCCCTCCTCCGCCTGCTCTTCCACGACTGCCAAGTCCAC
ACGTACGTACGCACGCACGCACGTAGTACGCCT
AGCTTGTTTGGATGTCAGTGTTATATATATCGATCGTTGCTGTGTGCGTGCGGCGCGCGCAACCGGCTGCAGGGATGTGACGGCTCCATATTGCTCAACTCCGACGAGCGCCGGCACATA
ACCTCGGAACTGGGCTCACGCAAGAACCTCGGGATCCGGCACGTCGGCACCGTCGGGCTCGTGAAGGCGGCCGTGGAAGCGGCCTGCCCTGGCCGGGTCTCCTGCGCCGACATCGTCGTC
CTGGCGGCGAGGGAGGCCGTGGCGCACACCGGCGGCCCGCGCGTCGCCAGCGTGCCCCTTGGCCGGAGGGACGCCACGACCACCAGCACGCAGGCCGCCGATGCGCAGCTTCCGTCCTGT
TTCCTCGGGATTGACGGCGCGCTCGACATCTTTACCAGCCGCGGCATGACCGTCGAGGAGACAGTCGCCATTCTAG
AGGTTTGATTTCGTACAATGCCAAATAAAAAAAATTGTTCTAAC
ATTCGTCACTACTCATGCACGGTGTCTGATCGTTCTTCATATATATCCATTCATATGCAGGGAGCCACACGCTGGGGGGTGGCCATTGCGTCAACATAGACACCGGTCGCGCGCGACGCG
ACAAGGCATTTGAGGCCCTGCTGCACCTGCAGTGCCCAAAGACCATGCCGCCTCTGATCACAGAGGCCGTCGTCTTTGTACCCAGCGACCTGACGCCGACATGGTTCGACACCCACTACT
ACCGGGGCGCCGCCGCAGGCCGGGGGCTCTTCAACGTCGACGACGAGGCCTCCACCTACGCGCGCACGGCGGGGTACGTGCGGCGGTTCGCTGAGGACAGGGAGGGCTTCTTCGGGGTCT
TCGCCTCGGCCTTCGTCAAGCTCTCTGGGTTTGGCGTGCTCACCGGTGAGCAGGGTGAGATCAGGAAGAAATGCGACGTCGTTAACTACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGTCTTCCTCACTTCCATCCAGACGTCATCATTCCTCTCGAGTAGTCGATCGGAGTCAGGAGATGGGCGCGTCTGGTGGTGAAAAGCTTGGTACTCTTGTGTGTGTTCTTGCACAT
GTATCGTTATTATTGGTGCTCGTGCTAGCACCGTGTGTGTGCAAGGCGACTGGTGGTGACTACGGCGGCCTCTCCAACGACCACTACACCGAGTCCTGCCCGGAGCTGGAGACCATCGTC
AAGAAGTCCCTGGCGCCGATCTTCGCCGTGGACATCACCTCGCCGGCCGCCCTCCTCCGCCTGCTCTTCCACGACTGCCAAGTCCAC
GGATGTGACGGCTCCATATTGCTCAACTCCGAC
GAGCGCCGGCACATAACCTCGGAACTGGGCTCACGCAAGAACCTCGGGATCCGGCACGTCGGCACCGTCGGGCTCGTGAAGGCGGCCGTGGAAGCGGCCTGCCCTGGCCGGGTCTCCTGC
GCCGACATCGTCGTCCTGGCGGCGAGGGAGGCCGTGGCGCACACCGGCGGCCCGCGCGTCGCCAGCGTGCCCCTTGGCCGGAGGGACGCCACGACCACCAGCACGCAGGCCGCCGATGCG
CAGCTTCCGTCCTGTTTCCTCGGGATTGACGGCGCGCTCGACATCTTTACCAGCCGCGGCATGACCGTCGAGGAGACAGTCGCCATTCTAG
GGAGCCACACGCTGGGGGGTGGCCATTGC
GTCAACATAGACACCGGTCGCGCGCGACGCGACAAGGCATTTGAGGCCCTGCTGCACCTGCAGTGCCCAAAGACCATGCCGCCTCTGATCACAGAGGCCGTCGTCTTTGTACCCAGCGAC
CTGACGCCGACATGGTTCGACACCCACTACTACCGGGGCGCCGCCGCAGGCCGGGGGCTCTTCAACGTCGACGACGAGGCCTCCACCTACGCGCGCACGGCGGGGTACGTGCGGCGGTTC
GCTGAGGACAGGGAGGGCTTCTTCGGGGTCTTCGCCTCGGCCTTCGTCAAGCTCTCTGGGTTTGGCGTGCTCACCGGTGAGCAGGGTGAGATCAGGAAGAAATGCGACGTCGTTAACTAC
TGA

Retrieve as FASTA