Entry information : TstKat01 (TstKatE)
Entry ID 7291
Creation 2010-04-11 (Marcel Zamocky)
Last sequence changes 2010-04-11 (Marcel Zamocky)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-06-29 (Christophe Dunand)
Peroxidase information: TstKat01 (TstKatE)
Name (synonym) TstKat01 (TstKatE)
Class Catalase    [Orthogroup: Kat001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Talaromyces
Organism Talaromyces stipitatus (Penicillium stipitatum)    [TaxId: 28564 ]
Cellular localisation Peroxisomal
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TstKat01
start..stop
S start..stop
PEchKat01 805 0 1..491 1..490
AclKat03 804 0 9..491 13..494
NcKat04 534 0 4..481 7..480
CnKat04_grubiiH99 527 0 4..481 6..487
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2993142..2993172 31 N° 2 2993219..2993348 130 N° 3 2993399..2993633 235 N° 4 2993686..2993778 93
N° 5 2993844..2994263 420 N° 6 2994318..2994402 85 N° 7 2994458..2995127 670  
join(2993142..2993172,2993219..2993348,2993399..2993633,2993686..2993778,2993844 ..2994263,2994318..2994402,2994458..2995127)


exon

Literature and cross-references TstKat01 (TstKatE)
Literature Fedorova N.D., Joardar V.S., Maiti R., Schobel S., Amedeo P., Galens K., Inman J.M., Galinsky K.J., White O.R., Whitty B.R., Wortman J.R., Nierman W.C. Genome sequence of Talaromyces stipitatus strain ATCC 10500. (unpublished since 2007).
Protein ref. UniProtKB:   B8MH83
DNA ref. GenBank:   EQ962656.1 (2993142..2995127)
Protein sequence: TstKat01 (TstKatE)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   491
PWM (Da):   %s   55046.73  
PI (pH):   %s   7.24
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSNPKFTTAEGHPIPDPSVSLTLPTIGGGGITTLGDTVLLETLAHFNRERIPERVVHAKASGAWGEFEVTNDISKYTSAKFLNGVGKKTPVLWRLSTTAGERGAADTVRDVRGFAVKFFTEEGNHDIVGNHIPVFFVRDPIRFPSLNRSHKRDPATNRPDWTMFWDFHVNQPESVHALMHLFGSRTVPDSIRRITGFGVHTFKLVAADGKIRYCKFHFKPTAGVTSWSSHDATRMAGVNPDFHGQDLWDAIARGEYPAWKLYLQVMEPEQAENYGRALFDITKVWSHKDFPLIEVGQMTLNKNPENYFAEIEQAAFSPANMVPGIAMTPDPMLQARMFAYADAARYRLGVNYTQLPPNRAICPVFAPFERDGYGTITRNYGGEPNYVRSTLSTGRVSQQAVYNTPITERIERNAILAQNEIQVDDDDYIQPRKFWIRVMDDNEKRLWIANVVETLETVPPQLRDAVAAMFSNVDARIGEALTAKARNNAHI

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns). Strain="ATCC 10500/CBS 375.48 / QM 6759 / NRRL 1006". No EST available.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTAATCCAAAGTTCACGACCGCCGAAGGTGAGAGATTCGATACATTGATTGTCCTTCTCTAACATCCTCCAAGGTCATCCCATTCCAGACCCCTCTGTCAGCCTTACACTACCTAC
AATTGGAGGCGGTGGCATCACCACACTCGGTGACACAGTCCTCCTTGAGACGCTTGCACACTTTAATCGTGAACGCATTCCTGAACG
GTGGGTTCAATATTCCCACGTCCACGTGTCTTC
AAGCTGATATCATACAGTGTTGTTCACGCCAAAGCCTCCGGAGCGTGGGGAGAGTTTGAAGTCACCAATGATATCTCTAAATACACATCTGCCAAATTCCTCAACGGTGTTGGCAAGAAG
ACTCCAGTGCTCTGGCGACTGAGTACCACTGCTGGTGAACGCGGTGCGGCAGATACCGTCCGTGATGTTCGAGGTTTTGCTGTCAAGTTCTTCACAGAGGAAGGTAACCATGACATAGTT
GGAAATCACATT
GTACAATTGGCCTGTTGTCCCGTTTGCAGTTGCTGGTAATAACTTTCAGCAGCCTGTGTTCTTTGTCCGTGACCCGATCAGATTCCCATCCCTCAACCGAAGCCACAA
GCGAGACCCTGCAACGAACCGTCCAGACTGGACTATG
GTAAGTACTCTAAAGCTACGCCGAGTCTCTCATAATGCACGAGCTAACGTATCTAAATTTCTCAGTTCTGGGACTTTCATGTC
AATCAACCAGAAAGTGTCCACGCTTTGATGCACCTTTTCGGCTCTCGTACAGTCCCGGACTCTATCCGCCGCATTACAGGTTTCGGTGTACATACCTTCAAGCTCGTCGCAGCAGACGGC
AAGATACGCTACTGCAAATTCCACTTCAAGCCTACAGCTGGCGTCACTTCATGGTCATCACATGATGCCACTCGTATGGCCGGTGTGAATCCCGACTTCCACGGTCAGGATCTCTGGGAT
GCCATTGCTCGCGGAGAGTACCCGGCCTGGAAACTCTACTTGCAGGTGATGGAGCCTGAACAAGCTGAGAACTACGGCAGGGCTCTTTTTGATATCACCAAAGTCTGGTCTCACAAGGAC
TTCCCCTTGATTGAAGTTGGTCAAATGACACTGAATAAAAAT
GTACGACCTGACTTTAAGTGCAAATAAGTAGTAGACACTGACCAGGACATCCAGCCCGAAAACTACTTTGCTGAGATT
GAACAAGCCGCCTTCAGCCCTGCGAACATGGTCCCCGGTATCGCCATGACACCGGATCCCA
GTAAGTAGCCAACAACTTTCCTGTCTCTTGGGCATTTTGCTAAGAGATTACCCAGTGTT
GCAAGCGCGTATGTTTGCCTATGCTGATGCCGCCCGATACCGTCTCGGTGTCAATTACACACAACTTCCCCCTAACCGAGCCATCTGCCCCGTCTTCGCCCCCTTTGAGCGTGACGGATA
TGGAACTATTACTCGTAACTACGGTGGTGAACCCAACTACGTGCGCAGCACATTGAGTACCGGCCGTGTCAGCCAACAAGCTGTGTATAACACGCCCATCACCGAGCGCATTGAGCGTAA
CGCGATCTTGGCCCAGAATGAAATTCAGGTTGACGACGACGACTATATCCAGCCACGCAAGTTCTGGATTCGAGTCATGGACGATAATGAGAAGAGGTTATGGATAGCCAATGTTGTGGA
GACATTGGAGACTGTTCCTCCTCAATTACGGGATGCTGTCGCGGCCATGTTCAGCAATGTTGATGCCCGTATTGGTGAAGCTTTGACCGCTAAAGCCAGGAATAACGCCCATATATAACT
GATACGAGGTCTCTTATAGTATTTCTGATTTATAGGAAGGGTCTTTTTTTCATGGACTTGGTGTTTCGAGTTGGGGCTTTTCTTTTCTCCTTCTATTGTGCTTGCAAGGATAAATCATGA
CACCTTTAACGGGAAAGATATAATTACTATCACTATATATTCAGGAATAAAATCTGATCTGAACCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTAATCCAAAGTTCACGACCGCCGAAGGTCATCCCATTCCAGACCCCTCTGTCAGCCTTACACTACCTACAATTGGAGGCGGTGGCATCACCACACTCGGTGACACAGTCCTCCTT
GAGACGCTTGCACACTTTAATCGTGAACGCATTCCTGAACG
TGTTGTTCACGCCAAAGCCTCCGGAGCGTGGGGAGAGTTTGAAGTCACCAATGATATCTCTAAATACACATCTGCCAAA
TTCCTCAACGGTGTTGGCAAGAAGACTCCAGTGCTCTGGCGACTGAGTACCACTGCTGGTGAACGCGGTGCGGCAGATACCGTCCGTGATGTTCGAGGTTTTGCTGTCAAGTTCTTCACA
GAGGAAGGTAACCATGACATAGTTGGAAATCACATT
CCTGTGTTCTTTGTCCGTGACCCGATCAGATTCCCATCCCTCAACCGAAGCCACAAGCGAGACCCTGCAACGAACCGTCCAGAC
TGGACTATG
TTCTGGGACTTTCATGTCAATCAACCAGAAAGTGTCCACGCTTTGATGCACCTTTTCGGCTCTCGTACAGTCCCGGACTCTATCCGCCGCATTACAGGTTTCGGTGTACAT
ACCTTCAAGCTCGTCGCAGCAGACGGCAAGATACGCTACTGCAAATTCCACTTCAAGCCTACAGCTGGCGTCACTTCATGGTCATCACATGATGCCACTCGTATGGCCGGTGTGAATCCC
GACTTCCACGGTCAGGATCTCTGGGATGCCATTGCTCGCGGAGAGTACCCGGCCTGGAAACTCTACTTGCAGGTGATGGAGCCTGAACAAGCTGAGAACTACGGCAGGGCTCTTTTTGAT
ATCACCAAAGTCTGGTCTCACAAGGACTTCCCCTTGATTGAAGTTGGTCAAATGACACTGAATAAAAAT
CCCGAAAACTACTTTGCTGAGATTGAACAAGCCGCCTTCAGCCCTGCGAAC
ATGGTCCCCGGTATCGCCATGACACCGGATCCCA
TGTTGCAAGCGCGTATGTTTGCCTATGCTGATGCCGCCCGATACCGTCTCGGTGTCAATTACACACAACTTCCCCCTAACCGAGCC
ATCTGCCCCGTCTTCGCCCCCTTTGAGCGTGACGGATATGGAACTATTACTCGTAACTACGGTGGTGAACCCAACTACGTGCGCAGCACATTGAGTACCGGCCGTGTCAGCCAACAAGCT
GTGTATAACACGCCCATCACCGAGCGCATTGAGCGTAACGCGATCTTGGCCCAGAATGAAATTCAGGTTGACGACGACGACTATATCCAGCCACGCAAGTTCTGGATTCGAGTCATGGAC
GATAATGAGAAGAGGTTATGGATAGCCAATGTTGTGGAGACATTGGAGACTGTTCCTCCTCAATTACGGGATGCTGTCGCGGCCATGTTCAGCAATGTTGATGCCCGTATTGGTGAAGCT
TTGACCGCTAAAGCCAGGAATAACGCCCATATATAACTGATACGAGGTCTCTTATAGTATTTCTGATTTATAGGAAGGGTCTTTTTTTCATGGACTTGGTGTTTCGAGTTGGGGCTTTTC
TTTTCTCCTTCTATTGTGCTTGCAAGGATAAATCATGACACCTTTAACGGGAAAGATATAATTACTATCACTATATATTCAGGAATAAAATCTGATCTGAACCT

Retrieve as FASTA