Entry information : ZmPrx02(Zm00001d029274 / GRMZM2G040638 [6a] / Pox2 / PRX2 / PER2 / Peroxidase66)
Entry ID 733
Creation 2006-07-13 (Christophe Dunand)
Last sequence changes 2010-12-23 (Marie Brette (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2023-01-09 (Christophe Dunand)
Peroxidase information: ZmPrx02(Zm00001d029274 / GRMZM2G040638 [6a] / Pox2 / PRX2 / PER2 / Peroxidase66)
Name ZmPrx02(Zm00001d029274 / GRMZM2G040638 [6a] / Pox2 / PRX2 / PER2 / Peroxidase66)
Class Class III peroxidase    [Orthogroup: Prx052]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type Roots
Inducer Lignification
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx02
start..stop
S start..stop
SiPrx148 585 0 27..335 16..326
SbPrx16 578 0 27..335 17..328
TaPrx44-2B 555 0 14..335 10..332
TaPrx44-1B 555 0 14..335 10..332
Gene structure Fichier Exons


exon

Literature and cross-references ZmPrx02(Zm00001d029274 / GRMZM2G040638 [6a] / Pox2 / PRX2 / PER2 / Peroxidase66)
Literature de Obeso,M. et al., Gene 309 (1), 23-33 (2003)
Protein ref. UniProtKB:   B6TJQ7  Q9FEQ8 [Mismatch]
DNA ref. GenBank:   AC208576 (21718..22816)
mRNA ref. GenBank:   AJ401275
Protein sequence: ZmPrx02(Zm00001d029274 / GRMZM2G040638 [6a] / Pox2 / PRX2 / PER2 / Peroxidase66)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (306)
PWM (Da):   %s   35538.65 (32796.2) Transmb domain:   %s   i13-35o (i13-35o)
PI (pH):   %s   5.15 (4.98) Peptide Signal:   %s   cut: 30 range:30-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAATAPKTMPSSVFAAALLLLAAAACQASPYYPLELGYYRYTCP
QAEAIVKASMEKAIAQNPGNGAAVIRMLFHDCFVE
GCDASVLLDPTPFSPTPEKLAAPNNPSLRGFELIDAIKDALEAACPGVVSCADIIAFAARDASCFLSQGKVSFDMPSGRLDGTFSNASESVKFLVPPTSNLSDLASSFAVKGMSLEDLVV
LSGAHTVGRSHCSSFVSDRLDVPSDINPALAAFLRTRCPANTTTSDDPTVMQDVVTPNAMDNQYYKNVLSHTVLFTSDAALLTSPETAKLVLDNAKIPGWWEDKFEKAMVKMASLEVKTG
HQGQVRKNCRAINHY*

Retrieve as FASTA  
Remarks Complete Sequence from genomic (chromo 1, intron 1) and 17 ESTs. ZmPrx110 and 02 are on the same contig. Cultivar="B73". GeneChip® Maize Genome Array ID: Zm.315.1.A1_at
DNA
Send to BLAST
CDS
Send to BLAST