Entry information : HaAPx04 (HanXRQChr15g0478771)
Entry ID 7354
Creation 2010-05-26 (Christophe Dunand)
Last sequence changes 2016-04-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaAPx04 (HanXRQChr15g0478771)
Name (synonym) HaAPx04 (HanXRQChr15g0478771)
Class Ascorbate peroxidase    [Orthogroup: APx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaAPx04
start..stop
S start..stop
HargAPx03 574 0 1..284 1..284
LsaAPx02 539 0 1..284 1..285
HaAPx03 532 0 1..284 1..285
CiAPx02 530 0 1..281 1..282
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 56400828..56400940 113 N° 2 56401018..56401142 125 N° 3 56402666..56402715 50 N° 4 56402885..56402950 66
N° 5 56403160..56403208 49 N° 6 56405135..56405217 83 N° 7 56405337..56405416 80 N° 8 56405514..56405616 103
N° 9 56406878..56407063 186  
join(56400828..56400940,56401018..56401142,56402666..56402715,56402885..56402950 ,56403160..56403208,56405135..56405217,56405337..56405416,56405514..56405616,564 06878..56407063)


exon

Literature and cross-references HaAPx04 (HanXRQChr15g0478771)
DNA ref. HanXRQ genome:   HanXRQChr15 (56400828..56407063)
EST ref. GenBank:   DY920043.1 [5' end]   CX947796.1 [3' end] Heliagene:   HaT13l001986 [Incorrect prediction]
Cluster/Prediction ref. HanXRQ:   HanXRQChr15g0478771 UniGene:   Han.2832
Protein sequence: HaAPx04 (HanXRQChr15g0478771)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   284
PWM (Da):   %s   31176.13 Transmb domain:   %s   o255-277i
PI (pH):   %s   7.19
Sequence 325
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAIPVVDSEYLKQIEKARRDLRAFIANKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRTEEEYSHGSNNGLKIAIDFCEDIKSKYPKITYADLYQLAGVVAVEVTGGPTVDFVPGRKDSKISPKEGRLPNATKGAPHLRDIFYRMGLSDKDIVALSGGHTLGRAHADRSGFEGPWTREPLKFDNSYFVELLKGESEGLLKLPTDLALLDDPVFRHYVELYAKDEDAFFNDYAISHKKLSELGCNPNAKKVTDSVVLAQSAVGVLVTAAVVVLSYVYEVRKKAK

Retrieve as FASTA  
Remarks Complete sequence from genomic and ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCGATTCCTGTTGTAGACTCCGAATACCTCAAACAGATCGAGAAAGCTCGTCGGGACCTTCGTGCCTTCATCGCCAACAAGAATTGCGCCCCGATTATGCTTCGATTAGCGTATGTTT
TTCGTCTTTCTGTTAATCATGTGTTTTGGTTATTGATGGTTGAATTGAGATGAATTGATGATGGTGTAGGTGGCATGATGCTGGAACGTACGATGTGAACACGAAGACTGGAGGACCTAA
TGGCTCGATTAGAACCGAGGAGGAGTATAGTCATGGATCGAATAATGGATTGAAGATTGCTATTGATTTTTGTG
GTAATTTTGTTTGTTATGGTTTGAATTGAAGTGATATGTTGTGATT
TAGGTGTGATAGTTTTGCTAATTGAAGTGTTCTTTTGTTAAATTAAGGTCAGATATAAAGTTTAAATTAGGCTTTTGTGTGTCAAGTAGACTGATTATGTAACTTTAGTCGAAGGTTTTC
TCTTAGAATGAGATGTTCTATTTTGTGAGAATTTGAAGTGAATTTCGATATCTTTTAGTAAGACTAAATGAATTCTTTATATACGGGGTCGAATCAACACTTTGGTAGTGGTGAAACGTC
ACAACCTTTGGGTATAACCACTGTGGTTAGGATGTAAGTGCTACATTTACATTAGTCGCAAGTTCAACATTGTCAGTAGCAACTGTGTTGCCACCGAAGGACTAAACCACACCTTAGTTG
CTACTTAGGCACAATTTGCTACTGAGTAGTAGCAACTTGCCACCAACCAAGTTGCTCCTGCTGCTTTTTTCTGTAACTTTAAGATCATTTTTAGTGCAACTTTTAGGCACCCGTGCAGAT
ACGATGCATTTCTACTGAATCCCCCAGCTAGGGGCTTTGCCTCTTGGACCCCATTGGGGCTACCCCTTGGAAATCCCTTACAACCTTAGAGGTTCCTTAGTACCAAACTCATAAGAATAT
TGAACGAGTGTGTACTTCATTCCTCCTAACTCGTATAGTTATCATGACTTCTCATTTGATACTAAAACACCAACAATAACTTCATGAATTGGTAAGGTTTATATTGGTTCTTATGGCAGA
TCCCAAACTGTGTCTAGTCAATAGCATTTGTGTTAATTACTTAGATGACTTAATAAGGGTGATATTATACTGTTGAAGTTTGATGTTAATTACTCAATTGAGTTAGTAAGTGATGTTATT
ACTCAAGTGATCTTATTTTGATGTAAAATTGTACTGTAATATTTCATGATGATCTCTAGGTATCATCTTCTTTTCATTTGAACTATGACTGGGGTAACATGATTGCTCCTTTAGGGTTAT
TTATATCAATATATAGCAGGAGACACCTTTGCTATTGATTAAAAAAATTTGCCATTTTCTTTTTAGTTTTTTGCTTAAAAAAAGTTCTTACACATAGGGAGTTTATAGCTTATTCTTCTA
CTGTTAAAAACTTAAGGTTACAAGAACATTAGTTTAGTGATTCTAGGCTGACTGATATTACAGTCAGATATTGCGGAGTATGTCGTCTTGAAAATGCACCCCTACCTTAATCATCTTGGG
TAGGCGATACTTGTAAGTTTTAGTTTAAAGAACTAATTTGAATCTTAAAAGCATTCTTTTTGTTGTCAAGATTAAAATTAAACTCCTTAAACCAAAGCTTGTTGTGTTTTCGTTCTAATT
AGTTGTGGCAAAAGCTTGTTGTGTTCCAATTTTAATCTTGACATCATTCTTCTTGCTAGAATTGATATTTGTAATTTTCGTCTACAAGAGAACATATTGACTTGAGTACCACTTCTCCTA
TTTGTTACTTTAACGAGCATTTTCTTTCTTACTGCAGAAGATATAAAGTCCAAATATCCAAAGATTACGTATGCAGATCTATATCAGGTGAACTCAATGATACATTGATACTATATAATT
TTGTTTCTATATATTAAGAGATGAGTTTGTGGTAACTTAACTCCTGTTCTAACATACACACAAGCACACACTGTACATGATGTGTTAAGTGTGAAGTTTAATTTACTACTCACCACAAAA
GGGTTTCTGTTTGTAGCTTGCAGGAGTTGTTGCTGTGGAGGTTACTGGTGGCCCTACTGTGGACTTTGTTCCTGGTAGAAAGGTATCTTGATTGATTCTATAACATTTTTTTTTCAACTT
TCTGTCAAGCTCTTCTCTTTTATTTTTCTTCTTTCGTGCTTGACTAGTCCTATGTCTTACCCATCTGTGCTTAATTTATATTGAAATTTTTGTCAAGTAAAGCATATATATATAAGAATG
CAATAGGAACTATTCCCTTCAAAAAGCTTACGTCTTCTGTCTTTTTTGTAGGATTCGAAGATCTCTCCCAAGGAAGGCAGACTCCCAAATGCTACCAAAGGTTTTTGATCCTACTTCTAT
ACCTTAATCATAATCTTATTTAACAAATGGGGTCTCTTTTTTAAATTGCTTCTTGGTAGTTACAAGATTTTTACAGGAGCAACTTTGAAGTTATCATTTTCATTACTGAAAGTAAATAAG
CTTACATTATCACTTGTGGGTACACACAGTGGTGGAGATAGGCTGTTTGTAGGGGGAGATAATTAGTTTAACTAATAACTACTGTAACAAACTTAACCATCTTTGTTTTTTTTGGAAAGG
GGACAGAACCCCGACAAACTTTATCAACAGAAAAAAAAAAGTTCAAAAAATACAAAATAGTTGAACTATAGCCCTTCCTGGGCTTTTGTGCCCAGCCCAATGAACTCTAGCATAGGCCCT
ATTCACATGGTCAAGAAGACCCAGCCCAAGCTTTAAATTCTTTCTGGACCACCCTTAAAATGGGCCCATGATAAGCCCATTTGAGATAACAAACAATCACAAAACTTAGATAATATCTTT
TGAGACTCTCCAATATGGAAATTACAAATTAATTTTTTCACAAAATTTCAACAAGTGAAAACCCCTACAAATGTGAATACATTACTGCATTTCATCAAATAATCAGCTAAAGTGTTGTAA
TAATCGCTAGGCGCTAGTCGGGCAGTGGGGTACCGACTAGCGATTAATCGGGATTAATAGGGATTAATCGGGTTGAGATTTTTGTATGTAATTTTTAGTTACATATATACACACACATTT
TTATATGTAGTTTTTTAAAGTAGACATGTTTTAACCCCTCATTGACCCATTTTTTTTAAGTAATGGGAAGGAATTTATAAGGTTTGGTCGAAATTTGGCCGGCGTCTGGCCAAAATTTGG
CCAGAATAGGACCGCCATTGACCGCCTAGCGATTAATCGGTGAACCTCCGATTAGTGATTAATGGGCGATTAATCGGAGACTAGTCGGGATTTTTACAACCATAAAGTATTTATTTACAG
ATACACAATAAAATCATACCCCTGGCGATAGTTATAACTGTTAGCTAATGACCTTAATGGATTTGACTCATTTGAAGTAAATATAAATTACTGTGTGCAACTGTTTATCTACTATGAAAG
GAAAATTTGGTCCACTATTTCAGCTGAAACTAATTTCGATAGTCTTCTTATTTACTGATTTGGTTATATCATGTACATGTTGCTGGAATATATTATTCATAGTTGTAAATTGTAATGGCA
TCACTAGAACTAAGAGTGTTTTCTGTTCATCCACCAATGCAAGACTTGCTGATCAGTCATTGGCAAATTACATAGCCCTCCTTTCAACTAGATATCAGTTTGCATTGAGTACATTGTCTG
ACTTATGCATTATCTTTTGCATGATCATGAGTGTACCGTGCAAGTGTGTAGCCACTTCTTTGGTACGTAAAACATACTTTGCATCATTGTCTTCGTTCGTGGTTATGGCCGATACCCACA
AAAGAATTCAAACATTCGATTCCTGAATTGGGTATTCTTTGATATTCTATAAACTCAAAAAGATTAATCAAAAGAAAAACCGAAAACTTATAGGAGGTTTCTGAGAATCAATCCTATAAG
AGGATTAGGTAAGAAAGGGCTTATGCTCTGAACGATCCCGAATGGCCGAGAATAGAAATATGTCACTTTGTTTATTGGCTCCTTTTGGGCTGACCATGTGAATTTCATTGAATTCGGACA
CCAAAATCAAGCCTGTCAGAATCAGAAAGATGGTTGTTTGATGACATGATCTCAGTGGTTCATGACATGATCAATATCTTTTGAACGGCATCCACTACATCATATTCTCCATGTCTATGC
TGACATGTTTTTCCAACACTTGTTATGCATGTTACTTCCATCAACATGATAACCTAGATGTAGATATCAGTTACATTCTTTTACTGAACTTATTATACTAATTTAGGCGCACCACACTTG
CGGGACATATTTTATCGCATGGGTTTATCTGACAAGGATATCGTAGCCCTGTCAGGAGGACACACTCTG
GTAAGTTGCTAATTACTCATTAAAATAATATCTTATGTAATTCCCAAAGCT
TGTTTTTTTTTAAAAAAAGTTTCTGTTTCAGCTTTCTAACTCATAATCTTGAAACTTTTTTGCTACAGGGAAGAGCACATGCAGATAGATCAGGCTTTGAAGGCCCTTGGACGAGGGAGC
CGCTGAAATTCGATAACTCGTATTTTGT
GTATATAACTTACTAAACCTTCATTTTCTTTATCCTTTATGGTTAAATAATAAATTATTACTTTTTAATTAATATGACATTAATATTGTGAA
ACCAGGGAACTTCTCAAAGGAGAATCAGAGGGGCTTTTGAAACTTCCTACCGACCTTGCATTGCTGGATGATCCTGTGTTCCGCCATTACGTTGAGCTGTACGCCAAGGTATGTGAATCT
AACTAGAAAAAAATAATGTTTTACTATAATCATAGACAACTAACCCCCTACCCCAACACAACAAACCGACCTTTAATAGGGTAAGTAGCTTAGCTACCCTCAACGACTAAAATGGAACAT
ATGAACAAACAAACATTAAATCCAAAATACAGTTGTGTGTTTGGTTTTGGCTAGATTGACAGTTGGGACCCTCTCTGGACTCTTGACTACTGGTCTGCTCACATTCTTCATTTTTCAACT
GTCCCCACCCTATCAACTTTGTAATTATAGCAACTCACATGCTGCCAACAACCTTGCAGAGGTTCTGGTACAAAGTTTGTCATATAAAACTAAATCCTACTTGGATATAACATGCCTTAG
ATTCCATCTCCAATTAATACTTGTACCGTACAATCTCTTAATGCAATGCCACACTTGATCTCTATAATTTACAACAGAGAAAATAACGAAAATGAACATTTTTAAGGTGATCACTTATCA
TAAATGTATCAGAATGTACAAACTTGATCCACTTTTATGAAAATAAAGCAGTTAAGCGAAATAATTTGTACAAATTTGATCCGTCTTTATGAAAATAAAGCAAATGCGGGAAATAAAGCG
AGTACATGAAAATAAAGTACACACGTGAATAAAAAGTAGACACTCAACAAAAACTTCGCGTAAATAAAAAAATGTAAAAAGTTTCTCAGGTTTGCACATTTCAAACCATTTATGATGATA
CGCGAACATAAGATAGATACGTGAAATAGTTTCACGTAATTCATGACTATAGAGGTAAAAATGTATGGCACGTACACTCAAGTATAAAATATAACCTAATAAATTTTTATTCTCGTGTAA
ATTCTCAAATATCAAATTTTAATTATCATGTTGCTTTGAATTTGTATGACTATTGTCAGTGGCGGATCTAGAAAATCCGCCAAGCCGTAACGTTTTATAAAAAAGCCGTAGCAAAATCGT
AAAAACGTCAAATTTTTCCAAAATTTACACTAATTTTACACTACCGCCGGAGCGCCAAGCCGTAGCGGAGGTTGCCCCTTCTTATATGCTAGGTCCGCCCCTGACTATTGTGCTACGAGT
CGAAGCCTTTTTTGTGTCACCTACATTGTACAATTGTACTACTGTATAACATAATATATGTACCAAGTTATACGGAAATCCTACAATGCATGTGAGACGAAAGAAGTGAGACAACAGATC
CGAGCTTATCAAATATGTTGCTCTAATCTTATGTTCCTGTATATTTCAGGATGAAGATGCATTCTTTAATGATTATGCAATATCACACAAGAAACTCTCTGAGCTAGGGTGCAACCCAAA
TGCTAAAAAGGTAACCGACAGCGTCGTATTGGCACAAAGCGCAGTGGGGGTTCTGGTGACTGCCGCTGTGGTGGTTCTCAGTTACGTTTATGAAGTCCGTAAAAAGGCCAAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCGATTCCTGTTGTAGACTCCGAATACCTCAAACAGATCGAGAAAGCTCGTCGGGACCTTCGTGCCTTCATCGCCAACAAGAATTGCGCCCCGATTATGCTTCGATTAGCGTGGCATG
ATGCTGGAACGTACGATGTGAACACGAAGACTGGAGGACCTAATGGCTCGATTAGAACCGAGGAGGAGTATAGTCATGGATCGAATAATGGATTGAAGATTGCTATTGATTTTTGTG
AAG
ATATAAAGTCCAAATATCCAAAGATTACGTATGCAGATCTATATCAG
CTTGCAGGAGTTGTTGCTGTGGAGGTTACTGGTGGCCCTACTGTGGACTTTGTTCCTGGTAGAAAGGATTCGA
AGATCTCTCCCAAGGAAGGCAGACTCCCAAATGCTACCAAAG
GCGCACCACACTTGCGGGACATATTTTATCGCATGGGTTTATCTGACAAGGATATCGTAGCCCTGTCAGGAGGACACA
CTCTG
GGAAGAGCACATGCAGATAGATCAGGCTTTGAAGGCCCTTGGACGAGGGAGCCGCTGAAATTCGATAACTCGTATTTTGTGGAACTTCTCAAAGGAGAATCAGAGGGGCTTTTGA
AACTTCCTACCGACCTTGCATTGCTGGATGATCCTGTGTTCCGCCATTACGTTGAGCTGTACGCCAAG
GATGAAGATGCATTCTTTAATGATTATGCAATATCACACAAGAAACTCTCTG
AGCTAGGGTGCAACCCAAATGCTAAAAAGGTAACCGACAGCGTCGTATTGGCACAAAGCGCAGTGGGGGTTCTGGTGACTGCCGCTGTGGTGGTTCTCAGTTACGTTTATGAAGTCCGTA
AAAAGGCCAAATAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTCAAACCA CGTTGGCGGA CTTTCACGAG TACACAAGCT TCTGATGGAA CTCAACCACA CAGGAACACA CCTTTATCTC CTAATTTTTT ATTCTATCTT TATTCGCCTG CAGTTTCAnn  CTnAGTCCAC GAACACACAC ACGGTAGTTA CACCCATCTT CACTGTGTGC AACTCATCCA TGGCGATTCC TGTTGTAGAC TCCGAATACC TCAAACAGAT CGAGAAAGCT CGTCGGGACC  TTCGTGCCTT CATCGCCAAC AAGAATTGCG CCCCGATTAT GCTTCGATTA GCGTGGCATG ATGCTGGAAC GTACGATGTG AACACGAAGA CTGGAGGACC TAATGGCTCG ATTAGAACCG  AGGAGGAGTA TAGTCATGGA TCGAATAATG GATTGAAGAT TGCTATTGAT TTTTGTGAAG ATATAAAGTC CAAATATCCA AAGATTACGT ATGCAGATCT ATATCAGCTT GCAGGAGTTG  TTGCTGTGGA GGTTACTGGT GGCCCTACTG TGGACTTTGT TCCTGGTAGA AAGGATTCGA AGATCTCTCC CAAGGAAGGC AGACTCCCAA ATGCTACCAA AGGCGCACCA CACTTGCGGG  ACATATTTTA TCGCATGGGT TTATCTGACA AGGATATCGT AGCCCTGTCA GGAGGACACA CTCTGGGAAG AGCACATGCA GATAGATCAG GCTTTGAAGG CCCTTGGACG AGGGAGCCGC  TGAAATTCGA TAACTCGTAT TTTGTGGAAC TTCTCAAAGG AGAATCAGAG GGGCTTTTGA AACTTCCTAC CGACCTTGCA TTGCTGGATG ATCCTGTGTT CCGCCATTAC GTTGAGCTGT  ACGCCAAGGA TGAAGATGCA TTCTTTAATG ATTATGCAAT ATCACACAAG AAACTCTCTG AGCTAGGGTG CAACCCAAAT GCTAAAAAGG TAACCGACAG CGTCGTATTG GCACAAAGCG  CAGTGGGGGT TCTGGTGACT GCCGCTGTGG TGGTTCTCAG TTACGTTTAT GAAGTCCGTA AAAAGGCCAA ATAAATAAAC CATAAAAACT TATAATTTTT AAACAAGTTG CAACTATCAA  TGAAGATGTT ACAAGTTTCT GTACAATTGT TTTGTTTACC TGAATTCTGG ATCTACTGTA AGGATTTATC TCAGCATAAT ACCGTTATTA AAACTCAACA GTTTGACTTT CTGTTTGTTT 
AGTTAATACG CAAAATAATG TAGGAACTTA TATTCCTTTG TGTCGACTCG TGTTTATTAA TATAATAAGT TTTAGATCTG ATCAAAAAA 

Retrieve as FASTA