Entry information : Sm2CysPrx01-2_96 (Sm2CysPrx01b_96)
Entry ID 7378
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2011-02-23 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-01-27 (Nizar Fawal)
Peroxidase information: Sm2CysPrx01-2_96 (Sm2CysPrx01b_96)
Name (synonym) Sm2CysPrx01-2_96 (Sm2CysPrx01b_96)
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Sm2CysPrx01-2_96
start..stop
S start..stop
Sm2CysPrx01-1_46 554 0 1..272 1..272
Gb2CysPrx 390 1.39e-138 37..271 44..279
Thas2CysPrx02 389 2.53e-138 58..271 67..278
Mpal2CysPrx01 389 2.72e-138 1..271 1..275
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7378' 'complement(join(52442..52561,52626..52739,52795..52920,52984..53063,53119..53200,53268..53345,53409..53627))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 53409..53627 217 N° 2 53268..53345 76 N° 3 53119..53200 80 N° 4 52984..53063 78
N° 5 52795..52920 124 N° 6 52626..52739 112 N° 7 52442..52561 118  
complement(join(52442..52561,52626..52739,52795..52920,52984..53063,53119..53200 ,53268..53345,53409..53627))


exon

Literature and cross-references Sm2CysPrx01-2_96 (Sm2CysPrx01b_96)
DNA ref. Phytozome 12:   scaffold_96 (52442..53627)
EST ref. GenBank:   FE516233.1 [5' end]
Cluster/Prediction ref. UniGene:   Smo.148
Protein sequence: Sm2CysPrx01-2_96 (Sm2CysPrx01b_96)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   272
PWM (Da):   %s   29285.16  
PI (pH):   %s   8.44
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATAGAAAFAATGHIVGGGATSSSSSAASAAPCRSSLFKAFDARLGASKISHLRRPAARIQPRRAFRSLAASASLDVPLVGNKAPDFEAESVFDQEFIKVKLSDYLGKKYVVLFFYPLDF
TFVCPTEITAFSDRYSEFEKINTEVLGVSVDSVFSHLAWVQTERKSGGLGDLRYPLVSDISKSISKAYNVLIPDQGIALRGLFIIDKEGIIQHATVNNLAIGRSVDETLRTLQAVQYVQD
NPDEVCPAGWKPGDKSMKPDPKLSKDYFAAIA

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns) and more than 100 ESTs. Unigene compiles ESTs from both haplotypes. Strain="Plant Delights".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACTGCTGGAGCAGCAGCATTCGCAGCGACTGGCCACATCGTGGGAGGAGGAGCCACCTCCTCGTCCTCGTCTGCCGCCTCTGCTGCTCCATGCCGATCGTCCCTCTTCAAGGCA
TTCGATGCGAGGCTAGGAGCGTCCAAGATTTCCCACCTCCGCCGCCCCGCCGCGCGGATCCAACCTAGGAGAGCTTTCAGGAGCCTGGCTGCTAGCGCG
GTGAGTCTAGCACTTTTCCAT
GGAGATTTCGACGCCTGCATTGTGGATTTTCCTCTTTTCTAGAGAGCTTGGATGTTCCATTGGTGGGAAACAAGGCTCCGGATTTCGAGGCCGAGTCGGTCTTCGATCAGGAATTCATCA
AG
GTATTTACGAGGAAAATGAAAGGTTACTCTTTGCTGTGTTCTTATTTCTCCCATGTCTTCGCCGCAGGTGTCAAGCTTTCGGACTACTTGGGCAAGAAGTACGTCGTTTTGTTCTTCT
ATCCTTTGGACTTCACGTTCGTTTGCCCGACAG
GTTGGTCGGTGACAAGTGGAAGATTTCTTCTAACTTTTTCTTTTCCTCCTGCTAGAAAAATCACCGCTTTCAGCGATCGTTACTCAG
AATTTGAGAAGATCAACACGGAAGTGCTCGGAGTCTCTGTTGACAGTGTG
GTACGTGGAACTTTTCTCTTTAATTTTCTTTGCTCTCTCGCTAACAAAAGGATGCTCTTGCAGTTTTTTC
CCATCTGGCTTGGGTTCAAACCGAGAGAAAGTCGGGCGGCCTAGGCGATTTGCGCTATCCCCTTGTTTCAGACATCTCCAAGTCGATCTCCAAGGCTTACAACGTACTCATCCCCGATCA
G
GTTCGTGACAAACTCCGTGTATACTTTGCGCAGATGACATTCTCTGTGTGTCCAGGGGGAATTGCCCTCCGAGGCCTCTTCATCATTGACAAAGAAGGGATCATCCAACACGCTACCGT
TAACAACCTTGCGATTGGAAGGAGTGTAGACGAGACCTTGAGAACGCTTCAG
GTGACGAAAGCTCTGGTGAATGCGAGTTTTAAGTTTTGATCTTTTTCTTCATTGTTTCTTCTAGGCGC
GGTCCAATTCGTCCAGGACAATCCAGACGAGGTGTGCCCCGCCGGATGGAAGCCTGGCGACAAGTCAATGAAGCCCGATCCAAAGTTGAGCAAGGACTACTTCGCTGCTATAGCTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACTG CTGGAGCAGC AGCATTCGCA GCGACTGGCC ACATCGTGGG AGGAGGAGCC ACCTCCTCGT CCTCGTCTGC CGCCTCTGCT GCTCCATGCC GATCGTCCCT CTTCAAGGCA  TTCGATGCGA GGCTAGGAGC GTCCAAGATT TCCCACCTCC GCCGCCCCGC CGCGCGGATC CAACCTAGGA GAGCTTTCAG GAGCCTGGCT GCTAGCGCGA GCTTGGATGT TCCATTGGTG  GGAAACAAGG CTCCGGATTT CGAGGCCGAG TCGGTCTTCG ATCAGGAATT CATCAAGGTC AAGCTTTCGG ACTACTTGGG CAAGAAGTAC GTCGTTTTGT TCTTCTATCC TTTGGACTTC  ACGTTCGTTT GCCCGACAGA AATCACCGCT TTCAGCGATC GTTACTCAGA ATTTGAGAAG ATCAACACGG AAGTGCTCGG AGTCTCTGTT GACAGTGTGT TTTCCCATCT GGCTTGGGTT  CAAACCGAGA GAAAGTCGGG CGGCCTAGGC GATTTGCGCT ATCCCCTTGT TTCAGACATC TCCAAGTCGA TCTCCAAGGC TTACAACGTA CTCATCCCCG ATCAGGGAAT TGCCCTCCGA  GGCCTCTTCA TCATTGACAA AGAAGGGATC ATCCAACACG CTACCGTTAA CAACCTTGCG ATTGGAAGGA GTGTAGACGA GACCTTGAGA ACGCTTCAGG CGGTCCAATT CGTCCAGGAC 
AATCCAGACG AGGTGTGCCC CGCCGGATGG AAGCCTGGCG ACAAGTCAAT GAAGCCCGAT CCAAAGTTGA GCAAGGACTA CTTCGCTGCT ATAGCTTGA 

Retrieve as FASTA