Entry information : ZmPrx42(Zm00001d022456 / GRMZM2G126261 / pmPOX3-1 / Peroxidase 42 / PRX42 / PER42)
Entry ID 738
Creation 2006-06-02 (Christophe Dunand)
Last sequence changes 2006-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2023-01-10 (Christophe Dunand)
Peroxidase information: ZmPrx42(Zm00001d022456 / GRMZM2G126261 / pmPOX3-1 / Peroxidase 42 / PRX42 / PER42)
Name ZmPrx42(Zm00001d022456 / GRMZM2G126261 / pmPOX3-1 / Peroxidase 42 / PRX42 / PER42)
Class Class III peroxidase    [Orthogroup: Prx173]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Flowers
Meristems
Mixed tissues
Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx42
start..stop
S start..stop
ZmPrx07 495 1.19e-178 34..320 34..320
ZmPrx66 491 9.52e-177 34..320 34..320
ZmPrx114 483 4.97e-174 30..319 24..313
SbPrx47 469 2.14e-168 30..321 23..313
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '738' 'join(172779135..172779362,172779540..172779725,172779827..172780378)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 172779135..172779362 226 N° 2 172779540..172779725 184 N° 3 172779827..172780378 550  
join(172779135..172779362,172779540..172779725,172779827..172780378)


exon

Literature and cross-references ZmPrx42(Zm00001d022456 / GRMZM2G126261 / pmPOX3-1 / Peroxidase 42 / PRX42 / PER42)
Literature Mika A., Luthje S. Production of active oxygen species and sequence analysis of plasma membrane-bound peroxidases from maize (Zea mays L.) roots. Submitted (OCT-2006) to the EMBL/GenBank/DDBJ databases
Protein ref. GenPept:   NP_001106019 UniProtKB:   A5H453-1  B4G1S4  B6T4Q8 [Incorrect splicing]
DNA ref. GenBank:   AC210153.3 (34854..33611)  AC211735.1 (87782..89021)
mRNA ref. GenBank:   EF059718
Cluster/Prediction ref. UniGene:   Zm.1616
Protein sequence: ZmPrx42(Zm00001d022456 / GRMZM2G126261 / pmPOX3-1 / Peroxidase 42 / PRX42 / PER42)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (292)
PWM (Da):   %s   32947.16 (30272.7) Transmb domain:   %s   i7-29o (i7-29o)
PI (pH):   %s   5.54 (5.54) Peptide Signal:   %s   cut: 30 range:30-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATSSGSCLIISLLVVVVAAALSASTASAQLSSTFYDTSCPSAMS
TISSGVNSAVAQQARVGASLLRLHFHDCFVQ
GCDASILLNDTSGEQTQPPNLTLNPRAFDVVNSIKAQVEAACPGVVSCADILAVAARDGVVALGGPSWTVLLGRRDSTGSFPSQTSDLPPPTSSLQALLAAYSKKNLDATDMVALSGAHT
IGQAQCSSFNGHIYNDTNINAAFATSLKANCPMSGGSSLAPLDTMTPTVFDNDYYKNLLSQKGLLHSDQELFNNGSTDSTVSNFASSSAAFTSAFTAAMVKMGNLGPLTGTSGQIRLTCW
KLNSS*

Retrieve as FASTA  
Remarks Complete sequence from 52 ESTs, from genomic (chromo 7, intron 1 and 2). Incorrect prediction from Phytozome (exon is not predicted). Cultivar="B73" and "hybrid".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACCTCCTCTGGTTCTTGCCTTATTATTAGCCTGTTGGTGGTGGTGGTGGCGGCGGCGCTGTCGGCCTCAACGGCGTCGGCACAGCTGTCGTCGACGTTCTACGACACGTCGTGC
CCCAGCGCGATGTCCACCATCAGCAGCGGCGTGAACTCCGCCGTGGCGCAGCAGGCTCGTGTGGGGGCGTCGCTGCTCCGGCTCCACTTCCACGACTGCTTCGTCCAA
AAGCAAGTCTAG
CTGTCTCAGATGCATCTATCTATCTACTTATATATAAGCATGATTTCCTTTCTAGCTAGCTAGCATCGTCGTGCATTTTAATTTGAAGATAAAAGATTAGCACGTCGTATATGCATGCGA
TTAATTAACCAGGAGGCATCATGGTGAAATTTCTGGTGGTCCACCAGGGCTGCGACGCGTCCATTCTGCTGAACGACACGTCCGGGGAGCAGACCCAGCCGCCGAACCTAACTCTGAACC
CGAGGGCCTTCGACGTCGTCAACAGCATCAAGGCGCAGGTGGAGGCGGCGTGCCCGGGCGTCGTCTCCTGCGCCGACATCCTCGCCGTCGCCGCCCGCGACGGAGTTGTCGCG
CGGTACG
TAGCTACATCACCGTGCCTATTAATTTGCTGGCTAGTAGCTTGTTGGTTTGCAAACTAACTAACTAATTCCGATCGTATGCGTGGTGCATATGCAGCTCGGCGGGCCTTCGTGGACCGTG
CTTCTGGGCAGAAGGGACTCGACCGGTTCGTTCCCTAGCCAGACAAGCGACCTCCCACCTCCGACGTCGAGCCTCCAAGCACTGTTAGCCGCGTACAGCAAGAAGAACCTCGACGCGACC
GACATGGTCGCTCTCTCAGGCGCTCACACAATCGGGCAGGCCCAGTGCTCGAGCTTCAACGGCCACATCTACAACGACACGAACATCAACGCGGCCTTCGCGACGTCGCTCAAGGCCAAC
TGCCCCATGTCCGGCGGCAGCAGCCTGGCGCCGCTGGACACCATGACCCCGACCGTGTTCGACAACGACTACTACAAGAACCTGCTGTCGCAGAAGGGGCTGCTGCACTCGGACCAGGAG
CTGTTCAACAACGGCAGCACCGACAGCACGGTCAGCAACTTTGCGTCCAGCTCGGCCGCCTTCACCAGCGCCTTCACGGCGGCCATGGTGAAGATGGGGAACCTCGGCCCGCTCACCGGG
ACCAGTGGGCAGATCAGGCTCACCTGCTGGAAGCTCAACTCGTCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACCTCCTCTGGTTCTTGCCTTATTATTAGCCTGTTGGTGGTGGTGGTGGCGGCGGCGCTGTCGGCCTCAACGGCGTCGGCACAGCTGTCGTCGACGTTCTACGACACGTCGTGC
CCCAGCGCGATGTCCACCATCAGCAGCGGCGTGAACTCCGCCGTGGCGCAGCAGGCTCGTGTGGGGGCGTCGCTGCTCCGGCTCCACTTCCACGACTGCTTCGTCCAA
GGCTGCGACGCG
TCCATTCTGCTGAACGACACGTCCGGGGAGCAGACCCAGCCGCCGAACCTAACTCTGAACCCGAGGGCCTTCGACGTCGTCAACAGCATCAAGGCGCAGGTGGAGGCGGCGTGCCCGGGC
GTCGTCTCCTGCGCCGACATCCTCGCCGTCGCCGCCCGCGACGGAGTTGTCGCG
CTCGGCGGGCCTTCGTGGACCGTGCTTCTGGGCAGAAGGGACTCGACCGGTTCGTTCCCTAGCCAG
ACAAGCGACCTCCCACCTCCGACGTCGAGCCTCCAAGCACTGTTAGCCGCGTACAGCAAGAAGAACCTCGACGCGACCGACATGGTCGCTCTCTCAGGCGCTCACACAATCGGGCAGGCC
CAGTGCTCGAGCTTCAACGGCCACATCTACAACGACACGAACATCAACGCGGCCTTCGCGACGTCGCTCAAGGCCAACTGCCCCATGTCCGGCGGCAGCAGCCTGGCGCCGCTGGACACC
ATGACCCCGACCGTGTTCGACAACGACTACTACAAGAACCTGCTGTCGCAGAAGGGGCTGCTGCACTCGGACCAGGAGCTGTTCAACAACGGCAGCACCGACAGCACGGTCAGCAACTTT
GCGTCCAGCTCGGCCGCCTTCACCAGCGCCTTCACGGCGGCCATGGTGAAGATGGGGAACCTCGGCCCGCTCACCGGGACCAGTGGGCAGATCAGGCTCACCTGCTGGAAGCTCAACTCG
TCCTAA

Retrieve as FASTA