Entry information : SmPrxII06-1_0 (SmPrxIIFa_0)
Entry ID 7382
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2010-05-31 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrxII06-1_0 (SmPrxIIFa_0)
Name (synonym) SmPrxII06-1_0 (SmPrxIIFa_0)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrxII06-1_0
start..stop
S start..stop
SmPrxII06-2_8 384 4.52e-139 1..188 1..188
MpPrxII04 255 7.95e-88 14..187 19..195
PpaPrxII06 243 3.26e-83 17..187 28..198
VvPrxII06 239 9.58e-82 3..187 7..199
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7382' 'complement(join(3475107..3475215,3475273..3475367,3475431..3475589,3475697..3475726,3475896..3476069))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3475896..3476069 172 N° 2 3475697..3475726 28 N° 3 3475431..3475589 157 N° 4 3475273..3475367 93
N° 5 3475107..3475215 107  
complement(join(3475107..3475215,3475273..3475367,3475431..3475589,3475697..3475 726,3475896..3476069))


exon

Literature and cross-references SmPrxII06-1_0 (SmPrxIIFa_0)
DNA ref. Phytozome 12:   scaffold_0 (3476069..3475107)
mRNA ref. JGI transcript:   74462 [Incorrect prediction]
EST ref. GenBank:   DN837952.1
Protein sequence: SmPrxII06-1_0 (SmPrxIIFa_0)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   188 (386)
PWM (Da):   %s   20518.69 (40754.6)  
PI (pH):   %s   9.23 (6.42) Peptide Signal:   %s   cut: 33 range:33-418
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRQRALRIQSTLSARSRSVVTVSSSLDLDSDLALQEARTWDQGLE
SQFATTPLSQIFK
DKRVVIFGTPGAFTGVCTKGHVPSYTKNVEQLKSKGVDSVICVAVNDPYTINAWAEKMNAKGKIQFFADFDGSFHKSLGLECDLSKALLGLRSQRWSAFVDDGVVKVLKVEKVPSELKVS
DGETMIKAIH

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns) and 1 EST. Incorrect prediction from JGI (5'end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGGCAACGAGCGCTGCGGATCCAATCCACATTGTCCGCGCGCTCGAGGTCCGTCGTCACAGTCTCTTCCAGCCTCGACTTAGATTCCGACCTCGCATTACAGGAAGCGCGGACCTGG
GACCAGGGTCTCGAATCCCAGTTCGCCACAACGCCGCTCTCCCAGATTTTCAAG
GTCAGTATTGCTATTCTGCATTCGCTAGCAATACGATAATCTTGCTATGAACTTTCACTAGTTCTT
GTGCTAGTATCTCATCAATCCCTTAGACAAAGTCTTCTAGCTCTAGACATTTAGAAGTTTCCTGTTCTCTTCATGTTCTCTTATCCCCTTTTTTGTCTTTCAGGAGACAAGCGTGTTGTC
ATCTTCGGTACTCCA
GTAAGTTATTCTTTCGTCTTTGTTGTTCTTCGAGGAAACAAGCAAAACTAAACAGAAGAAGAAGAAAAAAGAGATCGTAACTTACAATTCACTCCATTTCCATCC
AGGGGGCGCGTTCACGGGTGTCTGCACCAAGGGTCACGTCCCCAGCTACACCAAGAACGTCGAGCAGCTGAAATCCAAGGGCGTCGACTCCGTCATCTGCGTCGCGGTGAACGACCCCTA
CACCATCAACGCCTGGGCCGAGAAGATGAATGCAAAAGGCAAG
GTTAGCTTTCTTTTTCCTCCTCCTCTACGTGCGCTTATTTCTAAGAGTTTGGAACGCTCCCAGATATCCAGTTCTTC
GCCGATTTCGACGGTAGCTTCCACAAATCTCTGGGCTTGGAGTGTGATTTGAGCAAGGCGCTGCTTGGCCTTCGTTCGCAGAG
GTGGAGAAATCTCTTTCGGTATTTGCTTTTGACATTC
TTGAGAAATAAACTACGCAGGTGTGGTCAGCATTTGTGGACGATGGTGTGGTGAAAGTCCTCAAGGTGGAAAAGGTTCCTTCGGAGCTCAAGGTTAGCGATGGCGAGACGATGATCAAAG
CCATCCATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGGCAACGAGCGCTGCGGATCCAATCCACATTGTCCGCGCGCTCGAGGTCCGTCGTCACAGTCTCTTCCAGCCTCGACTTAGATTCCGACCTCGCATTACAGGAAGCGCGGACCTGG
GACCAGGGTCTCGAATCCCAGTTCGCCACAACGCCGCTCTCCCAGATTTTCAAG
GACAAGCGTGTTGTCATCTTCGGTACTCCAGGCGCGTTCACGGGTGTCTGCACCAAGGGTCACGTC
CCCAGCTACACCAAGAACGTCGAGCAGCTGAAATCCAAGGGCGTCGACTCCGTCATCTGCGTCGCGGTGAACGACCCCTACACCATCAACGCCTGGGCCGAGAAGATGAATGCAAAAGGC
AAG
ATCCAGTTCTTCGCCGATTTCGACGGTAGCTTCCACAAATCTCTGGGCTTGGAGTGTGATTTGAGCAAGGCGCTGCTTGGCCTTCGTTCGCAGAGGTGGTCAGCATTTGTGGACGAT
GGTGTGGTGAAAGTCCTCAAGGTGGAAAAGGTTCCTTCGGAGCTCAAGGTTAGCGATGGCGAGACGATGATCAAAGCCATCCATTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGGCAAC GAGCGCTGCG GATCCAATCC ACATTGTCCG CGCGCTCGAG GTCCGTCGTC ACAGTCTCTT CCAGCCTCGA CTTAGATTCC GACCTCGCAT TACAGGAAGC GCGGACCTGG  GACCAGGGTC TCGAATCCCA GTTCGCCACA ACGCCGCTCT CCCAGATTTT CAAGGACAAG CGTGTTGTCA TCTTCGGTAC TCCAGGCGCG TTCACGGGTG TCTGCACCAA GGGTCACGTC  CCCAGCTACA CCAAGAACGT CGAGCAGCTG AAATCCAAGG GCGTCGACTC CGTCATCTGC GTCGCGGTGA ACGACCCCTA CACCATCAAC GCCTGGGCCG AGAAGATGAA TGCAAAAGGC  AAGATCCAGT TCTTCGCCGA TTTCGACGGT AGCTTCCACA AATCTCTGGG CTTGGAGTGT GATTTGAGCA AGGCGCTGCT TGGCCTTCGT TCGCAGAGGT GGTCAGCATT TGTGGACGAT 
GGTGTGGTGA AAGTCCTCAA GGTGGAAAAG GTTCCTTCGG AGCTCAAGGT TAGCGATGGC GAGACGATGA TCAAAGCCAT CCATTAA 

Retrieve as FASTA