1. Browse the Database
  2. View Redoxidase
Entry information : SmPrxQ-2_31 (SmPrxQb_31)
Entry ID 7383
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2010-05-31 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrxQ-2_31 (SmPrxQb_31)
Name (synonym) SmPrxQ-2_31 (SmPrxQb_31)
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrxQ-2_31
start..stop		 S start..stop
SmPrxQ-1_21 444 1.25e-161 1..220 1..220
PabPrxQ23 278 4.44e-96 62..220 57..219
PabPrxQ22 271 2.73e-93 44..220 38..219
GbPrxQ01 265 4.99e-91 63..220 66..222
Gene structure Fichier Exons►


exon

Literature and cross-references SmPrxQ-2_31 (SmPrxQb_31)
DNA ref. Phytozome 12:   scaffold_31 (310820..309427)
mRNA ref. JGI transcript:   443212
EST ref. GenBank:   828  DN839008.1
Protein sequence: SmPrxQ-2_31 (SmPrxQb_31)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   220
PWM (Da):   %s   23528.12 Transmb domain:   %s   i5-27o
PI (pH):   %s   9.8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSAAPLCGGAVLAAAAPRKSPASSSCAAILRPPCLASSSIAAESSLFRRVCGLGVAKSPSRTLLSTSCKLSQGDVLPSFNLKDQEGRVVNSSKFKNKPVVLYFYPADESPGCTKEAC
AFRDSYDKFRKAGAEVIGISADTPESHKAFAKKYRLPFTLLTDEGNKLRKDWGIPGDFFGSLPGRQTYVIDKKGVVRLVFNNQFQPEKHAMETLKVLESM*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and ESTs. Unigene compiles ESTs from both haplotypes.
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST