Entry information : ZmPrx01(Zm00001d040702 / GRMZM2G104394[6a] / pmPOX1)
Entry ID 739
Creation 2005-06-13 (Christophe Dunand)
Last sequence changes 2011-01-20 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2023-01-02 (Christophe Dunand)
Peroxidase information: ZmPrx01(Zm00001d040702 / GRMZM2G104394[6a] / pmPOX1)
Name ZmPrx01(Zm00001d040702 / GRMZM2G104394[6a] / pmPOX1)
Class Class III peroxidase    [Orthogroup: Prx126]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Meristems
Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx01
start..stop
S start..stop
SbPrx60 625 0 2..367 3..370
SiPrx05 570 0 28..367 26..359
TaPrx31-1D 494 7.44e-177 17..367 12..347
HvPrx10 492 1.61e-176 12..339 6..330
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '739' 'join(59037449..59037688,59043616..59044056,59044149..59044571)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 59037449..59037688 238 N° 2 59043616..59044056 439 N° 3 59044149..59044571 421  
join(59037449..59037688,59043616..59044056,59044149..59044571)


exon

Literature and cross-references ZmPrx01(Zm00001d040702 / GRMZM2G104394[6a] / pmPOX1)
Literature REFERENCE 1 de Obeso,M. et al., Gene 309 (1), 23-33 (2003).
REFERENCE 2 Mika A, Buck F, Luthje S. Membrane-bound class III peroxidases: Identification, biochemical properties and sequence analysis of isoenzymes purified from maize (Zea mays L.) roots.J Proteomics. 2008 Jun 17. doi:10.1016/j.jprot.2008.06.006
Protein ref. GenBank:   ABN48856 UniProtKB:   A5H8G4  B6TSD7
Cluster/Prediction ref. UniGene:   Zm.97216
Protein sequence: ZmPrx01(Zm00001d040702 / GRMZM2G104394[6a] / pmPOX1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   367
PWM (Da):   %s   38245.21 Transmb domain:   %s   i7-29o
PI (pH):   %s   7.17
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKESKLTAGVAAALTVVAACALCLLLPATARAQLRVGFYDTSCPNAEALVRQAVAAAFAKDAGIAAGLIRLHFHDCFVRGCDGSVLLTVNPGGGQTERDALPNNPSLRGFDVIDAAKTA
VEQSCPRTVSCADIVAFAARDSISLTGSVSYQVPAGRRDGRVSNATETVDLPPPTSTAQSLTDLFKVKELSVEDMVVLSGAHTVGRSFCASFFKRVWNTSTNPATAI
VDAGLSPSYAQLL
RALCPSNTTQTTPITTAMDPGTPNVLDNNYYKLLPRGMGLFFSDNQLRVNPQMAALVSSFASNETLWKEKFAAAMVKMGRIQVQTGTCGEVRLNCGVVNPSSYSSSSAVELGSSAPAAVG
EEGYAAS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, introns 1 and 3'), 13 ESTs and protein. Plasma membrane-bound peroxidase 1. Cultivar="line C (color-converted W22 maize line (inbred))". Unigene compiles the different cultivar. Containing IntR (3').
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGGAAAGCAAGCTAACGGCCGGGGTGGCCGCCGCGCTGACCGTCGTCGCCGCTTGCGCGCTATGCCTGCTGCTGCCGGCGACGGCCCGCGCGCAGCTCCGGGTGGGATTCTAC
GACACCAGCTGCCCCAACGCCGAGGCGCTCGTCCGCCAGGCCGTCGCGGCCGCCTTCGCCAAGGACGCCGGCATCGCCGCCGGCCTCATCCGCCTCCACTTCCACGACTGCTTTGTCAGG
GGGTAACAGAACCTCACTTTTTATTTTGATTATATTTATTACCAACTTGCAGCTTTAATTACCTAGCGGACATATAATAATACATGGAAAGGCGAGCTGCTGGTTGAAAGTTCTGACATG
ATAGCCCATGGGATTGGTTAAACAACCTTGAATGGAGAAAAAACACAAGTCTCTTGTGACTCGCACACAGTGTCTTCTGTCTCCATCTTGCGCTGATCACTTGTACGTATATGGTAGAAC
GACGACGCACAAATATTTAGACCCTGTTCGTCTTGTCTCAAATTAACACATGAAAATTGAAGAGGATTAGATCCTTAAAATCCTCTTTAATTCCCTCCTATCCCTCTTAAACTCTATGGT
TTATAGGGTTGAAACAGCAAGCCCATACGTTTTTTCTGTCCATGATTGATGCATTGATTAATATTAATTATTGATTTGTCCCTGTTCTCGATAGCTAACCACGATACAACAAGATATATA
TTGCTGAAAAGCATAGGCATCTTCAAGAGGATCCTTATTTTGAAATATAGGGGTCACGACCACCATAAAATGCCCTTCAACTGTGGCCCTATTTCATTAAAAATTTATCAAACGATTATA
GGGTCTAGTCTCTCTAAATCCTAAATATAGTACCCCATATATTCGAGTCCTATCCTAATTTCCTCTTAATATGCAACTATTTATTTCCTAATAACATAATTTATTTTCTAAATAGCATTA
TTTGAGGTCTAACTGTTGGAGTAAAATTTTCTTTTGGGGCCCTAAACACTTTGTAGTTCTATTTCAATTTTTAGGACTCTATTTTAGAGCTTCTTGTTGGAGATGCTCTAAAAAGTTTCA
AGACATTATTAATTGGGGCAATTGTGATTATACCCTTCTCCGGCATTGTAATTGCGATTTTACCCCTCGTTTTTCAACTTTGTGATTTTACCCCTATGTTTTGAAAATGAAGCCGTTGTT
GCCCCTCCCCCTTAACACCCATTAGTGAAAATCAGAATTAGTGATTAAAAAATAAAAATAATGGGTAAAATCACAATTGCAAGGTGAGAGAAGGGTATACCTTGCAATTGTGATTTTACC
CCTTATTTTTTATTTTTTTAATCACTAATTATGATTTTCACTAACGATGTTAGAGAGAGGGCCAAACGACATCTTCGTTTTCAAAACAAAGGGGTAAAATCACAAAGTTGAAAAACGAGT
GATAAAATTATAATTGAAAGGTAAGAGAAGGGTATAATCACATTGCCCCTTATTAATTTGCCTTGTCCAAGCTAGTTAGTTTTCACTATAAAACCATTCTCAATGGAAGTTTCATACTCA
TTTAATACAATGAAACTTATTGCTTGGTGTGCAATTATGAGAATACATATAGAGAATTTTATGGAAGATGGTAGAGTTTTATAGGGATGAAAATCTATATACATGGTTACCTAGTTTAAA
GACGATGTGACAGTATTGAAAACCGTGCATCAAACTCATCATGTGAGAATAGCCTAACCACTCCTAGCTACTAGTACAAACATAAAAGCAGATTCACCCACTTTAAATCACTTAATTTGT
GGCCTGGAATAATTCAGAGCATATTAGCTTGGAGTGTTTTGCCTGTATTGATTAGAGCTGCAACAGTCTAAATAACTGGCTTTAGTCCGTACAATTGGCTTCAAACTCTTCAAATTATAA
GGGTATGTACAACCTAGACACTGTTGCACGGTACTCCAAGTATAAGATACAACTAAAACACAACATAATACAGTGGACATGTCTAAAACATGTGTCTTACCATATTCATTGTACCAATCA
GAGCATTCAATAAATTAAAGTGACCAATCAGTTAGTCTCATGTCTCGAACATATAGCTAAGACACTGTGTCTTCGTCAAAATACATGTCTTGAGTTTTTTTATATTTACTCTATGGACAC
ACTCAAAGACACAACTCAAGACACACATTATGCATGCCCTAACACACGGTTCTTATTATGCAAGTATATTCTTTTTGTACAAGTATACCAGCACTCGTACGGAAATTTATTGATACCGTA
TTATTATTATATCGGAAAGCATAAAAGCGAAAGTTGTTTCTCGAGACAAACAAACAAAGTGTCCAAAGCAAAAGGCCCAAGACCAAATTAACGCAACATCCGTTCCGCTGCTTTCTTGCT
TGGCAGGCAACGCATATTCCCTGCAACTGTCGCCATGAATAACGTTTTTACCTTTGAGCACCCTGTATGTGTCGAATCGGTCCCACTCCTTATCTTTTGTATTCCCGGCATGCTTACATT
CTTGGATGACTCATGACTGTACCGAAATTAAAGACAGTCAACAACACTCAAACTGAAAAGCACACAAAAGCATAAATTAACAAGCATGTTTCCTAGCGGATTCTAGTATCTTCTTTAGGG
CTAGTTTGGAAACCTCATTTTCTCAATAGATTTCCATTTTTCAAAAAAAAAATTTTATTTTTCTCTTAGAAAAAATAGGAATAGTCTGATGGTATATCTCAGTATAGAAGATAGAAATAG
CGATATTTTTTTGTTTATAAACTCCCCTGGGGGCTAATCTCAGGAATGACGATTTTTGATACGATGCAAACGGTGACACATGATATATATACAATATGCCTCGGAATAGCCGCGTCCATG
GCCTCCTTCATTCTGCTTGGAGGAGAACCAACCAAGCATATAGCATTCCATCACGCTAGGATTATGCTTCACCAACCTGCTAGTGCTTATTATCGGGCAAGGACACCAGAATCCTTAGAA
AATATAGTTTTCAAATTAGCCCTTAATATAAAATAGCAAATGCATGACAAGAGCATTTCCATGTAAACTTCAGCCAAGAATAATGACTTTCTATAACGTTCTGATAATATCATAAATGTA
AGTAAATGTCTTCTATGACATTCTTACTAAAGAACATAATAAATTATAACATCCCTAGAGGCTAGGGTCTCTTAGGCGCCATAATTTATGATGTTCCTTAATAGAAATGTTACAAAAGAT
TTTTACTTATGCACCTTCTATGACACATATTATATCATCAAAACGTCATATAAAGTCAATTTTTTTTCTTGCGAGTAATAACATATTGGCCTATTTGCTATAGAAAGAAATATGAAACAT
TTTATCACCACGCCGCTTTATATTATGTGAAACCGAATGCTAAATTCGTACTCTATATATTATAAATTATAATAACCTAGATTTTCTAGGTTTGTTTTTACTATAAAATACTCAAAAACA
TATAATATAACTCACTATTATAGAAAGTCAATTTAGTAACCTTTGGAACATAGTGACCGAAGATCTCATTCTTTTAGTATAAGTTATATGGCTGGTACGAAAAGACCCTTTACAAGTCAT
GTGATTTTCGCATGAAATATGTGCTTGTGTGATACTAGGATTCAGACCAGGGACCTCTATGGTTTTCACATGTTTTCTCTTTACCACTTTACTATAGAGCTATTTGTGATTACAATGAAG
ATGTCTTCTCTTTTATTTTTTCGCTAGAACGATTAGTAGCAAAACTGATAAGGGTACCCTTTAGTACTAATTGATGTTATCAACCAGTACTAAAATAGACTCTTTAAAACTAGTTTTTAA
CACCAACACATACTAAAGTGTCTTTTGGACAATATCTATTATCAATCGATATTAAATATCCCTTTGGTATTGGTTCTAATTCAACTACTGGGACTAAATATGAAAAGTCTGAGGCCCTTT
TCTGTAGTGTAGACTATTTCAAGATCAAGTACCTAAGGAAATTCCACAATTTCTTTCTCTTTACCATGTGGAGAGCGGTACCACTTGCGTGATTATATAGAATATCGGTCATCTTAATGC
ATGTTTGAAAGATAGAAAATTTCGTATGTAGATACATAGCTGCTATGTACATAAAAAATCGTAAAATAACTTATAATCTAAAATAAATACAGAACTTCCAAGATATTAAGCAAAAAAAGA
CGACATTTTAGAAAAAAAATCCTTATATATCATGCTTATTAGTGATCTAAGGGGACTATCATCATTATTAAAAAAGGAAGGAAAATGAACATTTCACAAACATAGTTTGTTTGAGTAACA
ACTACAAGCTAATTTTACATCCACTCTCATGGTTACAAACTACAAATCGCTTTAGTTTGACAGATACGTCAAACATCTCTCGTTTTGACTAATTTTGGAGAAAAATATATAAACATCTGT
AACATTAAACATTATTCATTCGATACATCATGAATTTATTTGATAGCCTGTTATTTTCAAAAATCTTTATGCCTAATAAGGTGTTTGGTTTGAGAAATGAACTAGTCCATCATTTTCTCA
CTCCTCACTATTTTTGTTTGGTTTGTGTAATGGAATGAGTTGATCTATCACCACCTCATTCCTCATAGTTAGTTAGTACTAATATGAGGAATAAGTCATCCCACCAAATTTAAGAAATGA
ACCCATGATGCATTATCTCAATTTAGATATGGTGATTCCTTAAACCAAACACCTCCTAAATGTTTTTCCCAGTGATACCAAATTCTAATATGTTTGCATTGCGTCTGATACGAATTATCC
TCCACTCGAGCTCATGTGTTTGCGCCCTACCCAGTTTCGGTACGAAGACCCTGGATGTATATGTCCACGTTCGATATAAAGTCCTCAAAACTCATGCTTCCGTTCCGCGTGAATACTAAG
GCGCTCTCTAACGGCACCCTCCAACGGCTCACCCTCACATTCCCTGGGTACCGGGTGAGATAAAATTCTCAGCCTATGGATGCATGGGGGAGTTCCAATGTCCCCATTTGTTAATGACTG
CGTTTATTTGCGAAATTAACTTATTTTAAGCTTCGTAACCTTATAACAATGAGTATTACACGATACTACAAATATTATGATATTTTTTAAAACATCAAAAACAAATATAAAAATGTCAAA
TAGATGAGGTAACGTATATAAGAGGAATGGTTGGTGTGGATGAGAAATTGGGGGAAGAATGTTTTTGGGGAGGTATTTAAACATAAATAGAAAGTATGACTAGGGAGATTTTGGAGGGAG
AATAGTTAGATTCAACCTAAGATTTATTTCGAAAATCGTGACGCCGTCTAGCTCTGGTTGTTCTGGGCACCGCAACCGACGACGACGCCATCACGCCGTCCCGCTCATCATCCACCTAAA
GCCCAACCTACCACGTAAGTCGCTACTGACCGGCCATGAATTCTTGTGCGCTGGGATGACGGCCATCGTTGTTGTTGTGTGAGTGTCCTCGAACAAGATGTATGTAGATGTGTAGCACAT
CCGGTGGTGCAACGACCAGGTGTACTACCTCGCTGATGAGCTCGGGGTGCGCTTCATTTGACAGCCTAGCCAAGAGTCATCGGTACTCACCATATCGCGCGCGTTCCACGACTACTGTAT
TAAGGATTGTGGCATCATCTCGGCGCCGGAGGTGAGCAGAGGAGAACCGACAACAATGACCACTCGCCATCGTCGGGTAGCTTTTGTGTCGGCCTGCCTTTAATTCTTATCGTAAACACA
CACTTGCATTTTTTGTTTAAGCAAGCGTGTATGGTGGTGCATGCCTGATGACTAACGATGTACAATGGAACTTCTACCGGCAGGTGTGCACGTGCTCTCCAATGATGAGACCATAAAAAT
CATGACATATATTGAAGTCTGCATGATACTGATGATTGCAATGTAGTAGTGAAACAACTAAATTAAAATAGCAAAATTTATGTATGGCTAGGATCACAAATGGATAATGAAATATTTTCT
TATAACAATATAAGATACATTTTATATATAAGTTATCATGGTATTATATGTTCTCGTTCCAACGCACGGGTACTCACCTAGTAAACTATGAATTAGAAAGGTGTTCTGTGTCAGTTGACT
GTCCTTCCTGATTTCGTCTTCAATCCAACACTCCTAATCTACTATGCAGGGCTGTGATGGATCCGTCCTCCTCACCGTGAATCCTGGCGGCGGGCAGACTGAGCGTGACGCCCTCCCAAA
CAACCCGAGCCTCCGCGGCTTCGACGTGATCGACGCCGCCAAGACCGCCGTTGAGCAGAGCTGCCCGCGCACAGTCTCGTGCGCCGACATCGTCGCCTTCGCCGCCCGCGACAGCATCAG
TCTCACCGGGAGCGTCTCGTACCAGGTCCCCGCGGGCCGGCGCGACGGCCGCGTGTCCAACGCGACGGAGACCGTCGACCTACCCCCGCCCACCTCCACGGCGCAAAGCCTGACCGACTT
GTTCAAGGTCAAGGAGCTTAGCGTGGAGGACATGGTCGTCCTCTCCGGCGCTCACACCGTCGGCCGCTCCTTCTGCGCCTCCTTCTTCAAGCGCGTCTGGAACACAAGCACGAACCCCGC
TACCGCAATC
TCGTACGTAGCTAGTACACCGACATGGCTAATCAATTACTAGCTCGCTGCAGCCTGCAGGCACTCATGTGACACGTGCGGATGTACGACTGCAGGTGGACGCGGGGCTGA
GCCCGTCGTACGCGCAGCTACTACGCGCGCTGTGCCCGTCAAACACGACGCAGACGACGCCGATCACGACGGCCATGGACCCGGGAACGCCCAACGTGCTGGACAACAACTACTACAAGC
TCCTGCCTCGCGGCATGGGGCTCTTCTTCTCCGACAACCAGCTGCGCGTGAACCCGCAGATGGCCGCGCTGGTGAGCAGCTTCGCGTCCAACGAGACGCTGTGGAAGGAGAAATTCGCGG
CGGCCATGGTAAAGATGGGACGCATCCAGGTGCAGACAGGGACGTGCGGAGAGGTCCGTCTCAACTGCGGCGTCGTCAACCCGAGTTCGTACTCGTCGTCGTCGGCGGTGGAGCTGGGTT
CGAGCGCGCCAGCAGCCGTCGGTGAAGAGGGCTACGCCGCGAGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGGAAAGCAAGCTAACGGCCGGGGTGGCCGCCGCGCTGACCGTCGTCGCCGCTTGCGCGCTATGCCTGCTGCTGCCGGCGACGGCCCGCGCGCAGCTCCGGGTGGGATTCTAC
GACACCAGCTGCCCCAACGCCGAGGCGCTCGTCCGCCAGGCCGTCGCGGCCGCCTTCGCCAAGGACGCCGGCATCGCCGCCGGCCTCATCCGCCTCCACTTCCACGACTGCTTTGTCAGG
GGCTGTGATGGATCCGTCCTCCTCACCGTGAATCCTGGCGGCGGGCAGACTGAGCGTGACGCCCTCCCAAACAACCCGAGCCTCCGCGGCTTCGACGTGATCGACGCCGCCAAGACCGCC
GTTGAGCAGAGCTGCCCGCGCACAGTCTCGTGCGCCGACATCGTCGCCTTCGCCGCCCGCGACAGCATCAGTCTCACCGGGAGCGTCTCGTACCAGGTCCCCGCGGGCCGGCGCGACGGC
CGCGTGTCCAACGCGACGGAGACCGTCGACCTACCCCCGCCCACCTCCACGGCGCAAAGCCTGACCGACTTGTTCAAGGTCAAGGAGCTTAGCGTGGAGGACATGGTCGTCCTCTCCGGC
GCTCACACCGTCGGCCGCTCCTTCTGCGCCTCCTTCTTCAAGCGCGTCTGGAACACAAGCACGAACCCCGCTACCGCAATC
GTGGACGCGGGGCTGAGCCCGTCGTACGCGCAGCTACTA
CGCGCGCTGTGCCCGTCAAACACGACGCAGACGACGCCGATCACGACGGCCATGGACCCGGGAACGCCCAACGTGCTGGACAACAACTACTACAAGCTCCTGCCTCGCGGCATGGGGCTC
TTCTTCTCCGACAACCAGCTGCGCGTGAACCCGCAGATGGCCGCGCTGGTGAGCAGCTTCGCGTCCAACGAGACGCTGTGGAAGGAGAAATTCGCGGCGGCCATGGTAAAGATGGGACGC
ATCCAGGTGCAGACAGGGACGTGCGGAGAGGTCCGTCTCAACTGCGGCGTCGTCAACCCGAGTTCGTACTCGTCGTCGTCGGCGGTGGAGCTGGGTTCGAGCGCGCCAGCAGCCGTCGGT
GAAGAGGGCTACGCCGCGAGCTAG

Retrieve as FASTA