Entry information : ZmPrx44(Zm00001d040581 / GRMZM2G048474)
Entry ID 740
Creation 2009-01-12 (Christophe Dunand)
Last sequence changes 2010-12-23 (Marie Brette (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2023-01-09 (Christophe Dunand)
Peroxidase information: ZmPrx44(Zm00001d040581 / GRMZM2G048474)
Name ZmPrx44(Zm00001d040581 / GRMZM2G048474)
Class Class III peroxidase    [Orthogroup: Prx098]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx44
start..stop
S start..stop
ZmPrx107 684 0 1..348 1..348
SbPrx58 670 0 1..348 1..348
SbPrx59 645 0 1..348 1..349
SiPrx08 620 0 1..348 1..348
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 51498423..51498650 228 N° 2 51498747..51499565 819  
join(51498423..51498650,51498747..51499565)


exon

Literature and cross-references ZmPrx44(Zm00001d040581 / GRMZM2G048474)
Literature Alexandrov N.N., Brover V.V., Freidin S., Troukhan M.E., Tatarinova T.V., Zhang H., Swaller T.J., Lu Y.P., Bouck J., Flavell R.B., Feldmann K.A. Insights into corn genes derived from large-scale cDNA sequencing. Plant Mol. Biol. 69(1-2):179-194(2009).
Protein ref. UniProtKB:   B6UBA1 [Other strain]
DNA ref. GenBank:   AC187256.3 (65176..64037)
EST ref. GenBank:   EC901277.2 [5' end]   CK371024.1 [3' end]
Cluster/Prediction ref. UniGene:   Zm.122290
Protein sequence: ZmPrx44(Zm00001d040581 / GRMZM2G048474)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   348 (320)
PWM (Da):   %s   37897.29 (35192.8) Transmb domain:   %s   i7-29o (i7-29o)
PI (pH):   %s   6.64 (6.51) Peptide Signal:   %s   cut: 29 range:29-348
Sequence 389
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLSAAVLCALVAVQAAVLLATVPTAQASELEVGYYSKKCKGVENVVKWHVIKAIKANRRTGAALVRLIFHDCFVRGCDGSVLLDASYDNPHPEKEAPVNIGLAAFDVLEEIKAAVEKRCPGVVSCSDILIYAARDAASILSNGHVHFAVPAGRLDGFVSKAEEAQAELPDSTHDVQQLIDNFARKNFTVEELVILTGAHSIGQGHCSSFTGRLSEPPSQINPAYRDLLNYKCPQGSNPPVANNVRDEDYGVVARYMPGFTSRVRKIPDFLDNSFYHNNLAKIVTFHSDWTLLTNKEAFGHVVEYAENATLWDEDFSDSLLKLSKLPMPAGSTGEIRNKCSVVNHRLY

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, intron 1) and 10 ESTs (EE679471, EE032486, CF635167, CF637714, EC901276, DY235069). ESTs from ZmPrx44 and 107 are compiled in the same TCs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAAGCTCTCGGCGGCAGTCCTCTGCGCGCTTGTGGCTGTTCAGGCGGCGGTGCTTCTCGCCACCGTGCCGACGGCGCAGGCCAGCGAGCTGGAGGTCGGGTACTACAGCAAGAAATGCA
AGGGCGTGGAGAACGTGGTGAAGTGGCACGTCATCAAGGCGATCAAGGCCAACCGCCGCACCGGCGCCGCTCTCGTCCGCCTTATCTTCCATGACTGCTTCGTCAGG
GTAAGGGCACCAC
CATGCGTCCATGCGCATCCATCTACATATATAGCCAGTAAATCTTAATAGATTAATTAAACTGGGCATGCAATAATCATGCAGGGTTGCGACGGTTCTGTCCTTCTGGACGCTTCCTACG
ACAACCCTCACCCGGAGAAGGAGGCGCCGGTGAACATCGGGCTCGCAGCCTTCGACGTACTGGAGGAGATCAAGGCCGCTGTCGAGAAGAGGTGCCCCGGCGTGGTCTCCTGCTCCGACA
TCCTCATCTACGCCGCCCGCGACGCCGCCAGCATCCTCAGCAACGGCCACGTCCACTTCGCCGTCCCCGCAGGCCGCCTGGACGGCTTCGTCTCCAAGGCCGAGGAGGCCCAGGCGGAGC
TCCCGGACTCCACCCACGACGTGCAGCAGCTCATCGACAACTTCGCCAGGAAGAACTTCACCGTGGAGGAGCTCGTCATCCTCACCGGGGCGCACTCCATCGGCCAGGGCCACTGCTCGT
CCTTCACTGGCCGCCTCTCCGAGCCACCCAGCCAGATCAACCCGGCGTACCGCGACCTGCTCAACTACAAGTGCCCCCAGGGGTCCAACCCTCCCGTGGCCAACAACGTCCGCGACGAGG
ACTACGGCGTGGTGGCGAGGTACATGCCGGGGTTCACCAGCCGGGTGCGCAAGATCCCCGACTTCCTGGACAACTCCTTCTACCACAACAACCTCGCCAAGATCGTCACCTTCCACTCCG
ACTGGACGCTGCTCACCAACAAGGAGGCGTTCGGCCACGTCGTGGAGTACGCCGAGAACGCCACACTGTGGGACGAGGACTTCTCCGACTCGCTGCTCAAGCTCAGCAAGCTGCCCATGC
CAGCGGGAAGCACGGGCGAGATCAGGAACAAGTGCAGCGTCGTCAACCACCGCCTATACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAAGCTCTCGGCGGCAGTCCTCTGCGCGCTTGTGGCTGTTCAGGCGGCGGTGCTTCTCGCCACCGTGCCGACGGCGCAGGCCAGCGAGCTGGAGGTCGGGTACTACAGCAAGAAATGCA
AGGGCGTGGAGAACGTGGTGAAGTGGCACGTCATCAAGGCGATCAAGGCCAACCGCCGCACCGGCGCCGCTCTCGTCCGCCTTATCTTCCATGACTGCTTCGTCAGG
GGTTGCGACGGTT
CTGTCCTTCTGGACGCTTCCTACGACAACCCTCACCCGGAGAAGGAGGCGCCGGTGAACATCGGGCTCGCAGCCTTCGACGTACTGGAGGAGATCAAGGCCGCTGTCGAGAAGAGGTGCC
CCGGCGTGGTCTCCTGCTCCGACATCCTCATCTACGCCGCCCGCGACGCCGCCAGCATCCTCAGCAACGGCCACGTCCACTTCGCCGTCCCCGCAGGCCGCCTGGACGGCTTCGTCTCCA
AGGCCGAGGAGGCCCAGGCGGAGCTCCCGGACTCCACCCACGACGTGCAGCAGCTCATCGACAACTTCGCCAGGAAGAACTTCACCGTGGAGGAGCTCGTCATCCTCACCGGGGCGCACT
CCATCGGCCAGGGCCACTGCTCGTCCTTCACTGGCCGCCTCTCCGAGCCACCCAGCCAGATCAACCCGGCGTACCGCGACCTGCTCAACTACAAGTGCCCCCAGGGGTCCAACCCTCCCG
TGGCCAACAACGTCCGCGACGAGGACTACGGCGTGGTGGCGAGGTACATGCCGGGGTTCACCAGCCGGGTGCGCAAGATCCCCGACTTCCTGGACAACTCCTTCTACCACAACAACCTCG
CCAAGATCGTCACCTTCCACTCCGACTGGACGCTGCTCACCAACAAGGAGGCGTTCGGCCACGTCGTGGAGTACGCCGAGAACGCCACACTGTGGGACGAGGACTTCTCCGACTCGCTGC
TCAAGCTCAGCAAGCTGCCCATGCCAGCGGGAAGCACGGGCGAGATCAGGAACAAGTGCAGCGTCGTCAACCACCGCCTATACTAA

Retrieve as FASTA