1. Browse the Database
  2. View Redoxidase
Entry information : SmGPx02-2_57 (SmGPx02b_57)
Entry ID 7402
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2011-02-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-02-23 (Christophe Dunand)
Peroxidase information: SmGPx02-2_57 (SmGPx02b_57)
Name (synonym) SmGPx02-2_57 (SmGPx02b_57)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmGPx02-2_57
start..stop		 S start..stop
SmGPx02-1_0 336 1.05e-120 1..166 1..166
AcvGPx06-2 263 8.39e-92 3..166 2..165
GgGPx06 258 6.18e-90 2..166 3..166
MtGPx06 256 4.71e-88 1..166 67..231
Gene structure Fichier Exons►


exon

Literature and cross-references SmGPx02-2_57 (SmGPx02b_57)
DNA ref. JGI genome:   scaffold_57 (785490..784714)
mRNA ref. JGI transcript:   118012 [Incorrect prediction]
EST ref. GenBank:   FE462082.1
Cluster/Prediction ref. UniGene:   Smo.1482
Protein sequence: SmGPx02-2_57 (SmGPx02b_57)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   166 (295)
PWM (Da):   %s   18271.28 (31475.5)  
PI (pH):   %s   8 (6.23) Peptide Signal:   %s   cut: 23 range:23-317
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSSDKPSSIYDITVKDATGNDVSLGSYKDKVLLIVNVASQCGFTTTNYKELNELYEKYKDKGFEILAFPCNQFAGQEPGSNEEIQQTVCTRFKAEFPVFGKVNVNGADTAPVFKYLKSA
KGGGIFGDFIKWNFSKFLVSKTGEVVERYAPTTNPSKIEKDILKLL

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns) and ESTs. Incorrect prediction from JGI
DNA ►
Send to BLAST
cDNA►
Send to BLAST