1. Browse the Database
  2. View Redoxidase
Entry information : SbAPx07 (Sobic.006G084400.1[2.1] / Sb06g017080[1.4])
Entry ID 7416
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2014-08-04 (Messaoudi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-15 (Christophe Dunand)
Peroxidase information: SbAPx07 (Sobic.006G084400.1[2.1] / Sb06g017080[1.4])
Name (synonym) SbAPx07 (Sobic.006G084400.1[2.1] / Sb06g017080[1.4])
Class Ascorbate peroxidase    [Orthogroup: APx2002]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbAPx07
start..stop		 S start..stop
ZmAPx07 579 0 34..344 32..339
SiAPx05 568 0 1..344 1..342
BdiAPx07 553 0 46..344 46..345
TaAPx02-1B 550 0 47..344 47..348
Gene structure Fichier Exons►


exon

Literature and cross-references SbAPx07 (Sobic.006G084400.1[2.1] / Sb06g017080[1.4])
DNA ref. Phytozome 12:   chromosome_6 (46255843..46251527)
EST ref. GenBank:   BE356878.1 [5' end]
Protein sequence: SbAPx07 (Sobic.006G084400.1[2.1] / Sb06g017080[1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   344
PWM (Da):   %s   37156.01 Transmb domain:   %s   i7-29o
PI (pH):   %s   9.21
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAERLAASAATLRASAAAAATPSARRAARASRAFFPPSPASSARARVGLRAAPSPLPQKARAVRCAAVAAASDVAQVKAAREDIRELLRTTHCHPILVRLGWHDAGTYDKNIEEWPQRGG
ANGSLRFDVELKHGANAGLINALKLIQPIKDKYPSITYADLFQLASATAIEAGGPKIPMKYGRVDVTGPEQCPPEGKLPDAGPSSPADHLREVFYRMGLDDEIVALSGAHTLGRSRPERS
GWGKPETKYTKNGPGAPGGQSWTVEWLRFDNSYFKDIKEKRDQDLLVLPTDAALFEDPNFKVYAEKYAEDQDAFFSDYAEAHAKLSNLGAKFQPPQGFSLDD*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, 10 introns) and 3 ESTs.
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST