Entry information : PpaPrxII0301 (PpaPrxIIC01)
Entry ID 7426
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2010-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: PpaPrxII0301 (PpaPrxIIC01)
Name (synonym) PpaPrxII0301 (PpaPrxIIC01)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrxII0301
start..stop
S start..stop
HcPrxII03 232 8.93e-80 1..162 1..162
LePrxII02 232 1.53e-79 1..162 1..162
EguPrxII03 231 2.7e-79 1..162 1..162
EgrPrxII03 231 2.7e-79 1..162 1..162
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7426' 'complement(join(29363..29619,29798..29877,30350..30504))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 30350..30504 153 N° 2 29798..29877 78 N° 3 29363..29619 255  
complement(join(29363..29619,29798..29877,30350..30504))


exon

Literature and cross-references PpaPrxII0301 (PpaPrxIIC01)
DNA ref. Phytozome 12:   scaffold_43 (30504..29363)
Cluster/Prediction ref. UniGene:   Ppa.22318
Protein sequence: PpaPrxII0301 (PpaPrxIIC01)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   163 (326)
PWM (Da):   %s   17467.04 (35769.2)  
PI (pH):   %s   4.59 (6.15) Peptide Signal:   %s   cut: 27 range:27-352
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPIAVGDTIPDVTLSYLDDDNQSQKLSTHQDLKGKKVMLVAVPG
AFTPTC
SQEHVPGFIDNAKEIKSKGVSDIIVVVNDPFVMKAWERSYDGAEHLKFVADGSLEFTKALGLELDLTDKGLGVRSRRFCLLVDDLVVKVANIEEGGAFTVSGAEEILKALV

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns) and 6 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCCCATTGCAGTGGGTGATACGATCCCCGACGTGACGCTATCCTACTTGGACGATGACAACCAGAGCCAGAAGCTCAGCACGCACCAGGATTTGAAAGGCAAGAAAGTGATGCTT
GTTGCTGTTCCTGGCGCATTCACTCCCACTTGCAG
GTGAGTTGCTTCTTCATGCCTCGGTGTGCTTTTGTGTAAGGCTGGATCAGGTTCTTAACCCATTCTTTCTCCTTGTTTCAGTCGC
CGGGTCACGGTGAGGGAAGACATAGTGTTGCGTGGGTTAATCTTTTGGGTTTCGGTGTTGATGTGGAGTCTGCCGTGCTGTGGAGTTTCTCGAAAGATTAGTCAGCTCTGAGCCTCGATG
CGAGGTTTTTGTTTAGTTTTTCATGTGAAAATATCCTTCTGGAGGTGTCGAGTATCTTTTGAAATTGGAGAATAGTATTTCGTTTCGGTGCTTTTTTTTTAACATTGGGTTTTATGTTGA
GTCGTTTCGTTGGTCTATTTTGTGGTTTGATTGGAAACGTTGGACTGAATTACACTTCGCACTTAACAAGTAGTATGCGAATGTGTTGCAAACAATGTCATTATTCTGTGTACTGTCGCT
TATGGTTCACATGTCATTTTGTGGCAGCCCCAGGAACACGTTCCCGGTTTCATCGACAATGCCAAGGAGATCAAGAGCAAGGGTGTGTCGGACATCATCGTCGTCTCAGGTCTGTTTATC
ACATATCCGCCATGCATACGTGGGTTTCTACGATCCGTTCCTTAGGAATTGGGTTATGCGCCGATACTGCTTATCAGGGACGTTCTGCGCCAGAGTCGTGGTCCTTGAGGTTTCCTGAAA
CTCTGCATTTCAAGAGGAGTGATCGTGACGTAAGGTCTGTTGTGCAGTGTGAATGACCCGTTCGTCATGAAGGCATGGGAGCGTTCCTATGATGGTGCTGAACACCTCAAGTTTGTGGCC
GATGGTTCTCTAGAGTTCACCAAGGCGTTGGGATTGGAGCTGGACTTGACCGACAAGGGATTGGGCGTACGTTCTCGTAGATTCTGTCTACTGGTCGATGACTTGGTTGTGAAGGTTGCG
AACATTGAGGAAGGAGGTGCATTCACAGTTTCCGGAGCTGAGGAAATCTTGAAGGCGCTCGTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCCCATTGCAGTGGGTGATACGATCCCCGACGTGACGCTATCCTACTTGGACGATGACAACCAGAGCCAGAAGCTCAGCACGCACCAGGATTTGAAAGGCAAGAAAGTGATGCTT
GTTGCTGTTCCTGGCGCATTCACTCCCACTTGCAG
CCAGGAACACGTTCCCGGTTTCATCGACAATGCCAAGGAGATCAAGAGCAAGGGTGTGTCGGACATCATCGTCGTCTCAGTGAAT
GACCCGTTCGTCATGAAGGCATGGGAGCGTTCCTATGATGGTGCTGAACACCTCAAGTTTGTGGCCGATGGTTCTCTAGAGTTCACCAAGGCGTTGGGATTGGAGCTGGACTTGACCGAC
AAGGGATTGGGCGTACGTTCTCGTAGATTCTGTCTACTGGTCGATGACTTGGTTGTGAAGGTTGCGAACATTGAGGAAGGAGGTGCATTCACAGTTTCCGGAGCTGAGGAAATCTTGAAG
GCGCTCGTGTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCATTTTCTA CAGTTTTCTC CGCGGATTCT TTCTTGAAGA AGCTTTTTCG ATGCAACGTC AGTTGGGTTG AACCAGAAAT GGCCCCCATT GCAGTGGGTG ATACGATCCC CGACGTGACG  CTATCCTACT TGGACGATGA CAACCAGAGC CAGAAGCTCA GCACGCACCA GGATTTGAAA GGCAAGAAAG TGATGCTTGT TGCTGTTCCT GGCGCATTCA CTCCCACTTG CAGCCAGGAA  CACGTTCCCG GTTTCATCGA CAATGCCAAG GAGATCAAGA GCAAGGGTGT GTCGGACATC ATCGTCGTCT CAGTGAATGA CCCGTTCGTC ATGAAGGCAT GGGAGCGTTC CTATGATGGT  GCTGAACACC TCAAGTTTGT GGCCGATGGT TCTCTAGAGT TCACCAAGGC GTTGGGATTG GAGCTGGACT TGACCGACAA GGGATTGGGC GTACGTTCTC GTAGATTCTG TCTACTGGTC  GATGACTTGG TTGTGAAGGT TGCGAACATT GAGGAAGGAG GTGCATTCAC AGTTTCCGGA GCTGAGGAAA TCTTGAAGGC GCTCGTGTGA AGTGGAGGAA GTCTCATAGC TCTCTTTGTG  AAGACGATTT CTTGAAACAT ACTAGTTTCT CTGTGAATTG AACCTTACTT CAAGTACTTG AAATTGCCAC ATTTTGGAGG TGTTCAAACT CTTGCGAAGT GTTGTGAAGC TCCGAGCTTG 
CAATGAGGTA CATCTGnATC TTAAGTAAAC AC 

Retrieve as FASTA