Entry information : PtAPx[P]09 (POPTR_0006s08980 / Potri.006G089000)
Entry ID 7435
Creation 2010-07-09 (Christophe Dunand)
Last sequence changes 2011-01-28 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Qiang Li
Last annotation changes 2012-03-07 (Qiang Li)
Peroxidase information: PtAPx[P]09 (POPTR_0006s08980 / Potri.006G089000)
Name (synonym) PtAPx[P]09 (POPTR_0006s08980 / Potri.006G089000)
Class Ascorbate peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtAPx[P]09
start..stop
S start..stop
PtAPx03 186 5.5e-61 1..110 12..120
PbAPx02 186 5.5e-61 1..110 12..120
PtreAPx01 185 9.69e-61 1..110 12..120
YfiAPx01 179 1.13e-59 1..110 12..120
Gene structure Fichier Exons


exon

Literature and cross-references PtAPx[P]09 (POPTR_0006s08980 / Potri.006G089000)
DNA ref. Phytozome 12:   scaffold_6 (6611611..6612141)
Omic ref. ePlant:   Potri.006G089000
Protein sequence: PtAPx[P]09 (POPTR_0006s08980 / Potri.006G089000)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   115
PWM (Da):   %s   12404.52  
PI (pH):   %s   9.72
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
YSKAVEKAKKKLRSLIAKMNCAHLSLCLARWYSAGTFGVKTKTDGPFGTMRYSAELAHGANNGLDIAVRLLEPIKEQFPILSYADFYLAGVVSVAITGGPEVPFHPRSEPSIVL*

Retrieve as FASTA  
Remarks Pseudogene. Sequence from genomic (chromo 6). 5' and 3' ends are missing.
DNA
Send to BLAST
CDS
Send to BLAST