Entry information : BdiAPx-R (Bradi3g40330)
Entry ID 7459
Creation 2010-08-09 (Christophe Dunand)
Last sequence changes 2010-08-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-05-03 (Christophe Dunand)
Peroxidase information: BdiAPx-R (Bradi3g40330)
Name (synonym) BdiAPx-R (Bradi3g40330)
Class Ascorbate peroxidase related    [Orthogroup: APx-R001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiAPx-R
start..stop
S start..stop
HvAPx-R 555 0 1..328 1..331
TaAPx-R01-1B 552 0 1..329 1..333
FarAPx-R 540 0 1..329 1..332
TaAPx-R01-1D 536 0 1..329 1..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 42505417..42505493 77 N° 2 42505587..42505699 113 N° 3 42506060..42506150 91 N° 4 42506424..42506551 128
N° 5 42506781..42506851 71 N° 6 42506981..42507023 43 N° 7 42507105..42507201 97 N° 8 42507335..42507418 84
N° 9 42507700..42507821 122 N° 10 42507911..42507971 61 N° 11 42508130..42508232 103  
join(42505417..42505493,42505587..42505699,42506060..42506150,42506424..42506551 ,42506781..42506851,42506981..42507023,42507105..42507201,42507335..42507418,425 07700..42507821,42507911..42507971,42508130..42508232)


exon

Literature and cross-references BdiAPx-R (Bradi3g40330)
DNA ref. Phytozome 12:   Bd3 (42505417..42508232)
Cluster/Prediction ref. UniGene:   Bdi.11061
Protein sequence: BdiAPx-R (Bradi3g40330)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329
PWM (Da):   %s   35331.87  
PI (pH):   %s   6.75
Sequence 370
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MELTNIPHLASSSNFFFSSCSRCSCRGRRTEKAVIAVSVAGIRCGADSACSEITEQQNLDSLPGSKNSRCYRRRDFAAAALIPFLLPRVDMASAAESYDASIIQNGARNVLSKVKAAGVLRLVFHDAGTFDVAEKSGGMNGSIIYEVDRPENAGLSKSLKILQKAKEGIDQIQKVSWADLIAVAGAEAVALCGGPEIPVRLGRLDSSIADPVGKLPEETLDAVALKTSFRNKGFSTQEMVVLSGAHTIGGKGFGNPNVFDNSYFKVLLEKPRPTSSGMPIGLPTDWALTEDDECLRWINIYAEDQAKFFADFQDAYTKLVNSGASWRTA

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 10 introns) and 23 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGAGCTCACCAACATCCCCCATCTCGCCTCCTCCTCCAACTTCTTCTTCTCCAGCTGCAGTCGCTGTTCCTGCAGGTAATGTTTTCGTCCATTATCAGGCTCTAATTCCAGCCATGCAG
TCATGAGTACATGGGATGCAAATCACCTGTGAAAATTGTGATGCTACAGGGGCAGAAGAACCGAGAAGGCGGTGATAGCAGTGTCTGTTGCTGGAATTAGGTGCGGTGCTGATTCTGCAT
GTTCAGAAATCACTGAGCAGCAAAATCTAGATTCCCTTCCAG
GTACGGCGCAGTAGATATGTTTTGTGCTTCAGTTAGAACATGAAATGTTTCCCGGCTAATTTCCTAGTAAATCATTCT
GTAGTGTCAAGAGCAGTTAGAACAACTCTTAGGGAAGTCTGCACCTTGAAAATTATTGCTGATAAATAGTATACTTCCCACCAGGATTTCCAGAATTAAGGCTAGTAACTACAATTGGAC
ATTTTTTCCATAAACTTGGTCGAACTTTACGAAAATTGAAATAAGACAAAGCTAGAACATCTTATAATTTGGAGCCGAGGGAGTAAGAATTAAGAAGTTTCTTCAAGTTTGTGCTAGTAT
ATTGCTGGCGAGTTGAATTTGCTTTGTGTACAATGGCCTCAGGTTCTAAAAATTCCCGCTGTTACAGAAGGAGAGACTTTGCTGCTGCTGCTCTGATCCCTTTTCTACTTCCTCGTGTTG
ATATGGCAAGTGC
GTAAGTACACTATTCGACCACTATCACTTTCCTACTTTGCACTTAGTTATAATAGCTATGAGTTCCTAACATTATTGACCTGCATTTACATGAGCATTTTTGTCATG
ACTCATGATCGATTTGTTCGACTGTGCAAGCATGAACTATTAAAAAATGAAGTGGGCCTATGATAGAGATTTGCAGAGAAGAGTGACCTGATCAAAGTTGTTTCTTGCTATTAAACACCA
GTATTGAAACTTTAGAGAAGTTCCCTGATTACGATTAACTTTATAGGGCTGAGTCATATGATGCATCAATTATTCAAAATGGTGCGAGGAATGTTTTATCCAAGGTCAAAGCTGCTGGCG
TGCTTCGTTTGGTTTTCCATGATGCAGGGACTTTTGATGTTGCTGAAAAATCAG
GTTTAGTCATGTTTGTCTTCAGCTACCAAAGTTTTCCCTAAACCAGCGACAATTCGGATGGGAGGG
AGTAATAGTTTCTGAGCAAGGATTGCAGGTGTTTAAAAGCCTAATGATTTAAAATTGGGAAATCAAATATGCTAAAGTATGGTTCGAAGATATCGAACAGTGGATTTTTTGCAAAGCAGA
AAAAAATAGGCAAACATCGGTAATTGGTTGCACTATGTTGCAGGTGGCATGAATGGCTCTATAATTTATGAAGTTGACAGACCTGAAAATGCTGGACTAAGTAAATCTTTAAAGGTTTTT
TATTTTTCTGAAAGTACCTTTACAGCACATCTTTCTTCTTTGCTTGTTGTCATGTATAGTGCGATTTCCTACTGAGGAACACCTGACTTGACATGTCTGTTTGATCGCTTTAAAACTGAA
TAGATACTGCAAAAAGCAAAAGAAGGAATCGATCAAATTCAGAAAGGTATGTTCTTTACACGTGTGTTGTCTTTATTGAACAAAGCTTTCTGTATCCTGAAGTCAATCTATTATTGTTCC
GCTATAGTATCATGGGCAGACTTGATTGCGGTGGCTGGTGCCGAGGCAGTTGCACTCTGTGGAGGGCCTGAAATTCCAGTAAGACTAGGCCGATTAGATTCCAGGTGCAACATAGTAGTT
TCTTCATTTTACAATGTCCACAGAGTATTACTCAAACTTTAAGCTATTCCATGAGTTGTTTCTATTTACTCTACCTATCTGCCTGAATTCTTCTGAAAGAATGCTTTTGCCGCGTAGCAT
TGCTGATCCTGTTGGCAAACTTCCTGAAGAAACATTGGATGCTGTTGCCTTGAAAACATCATTCAGAAACAAGGGTTTTTC
GTGAGTCCTTTTATTTATTAACTTTCTTTATCGCTGTCC
ATTCTGGAATTGATATACTCCCTCCGTCCCATATTAAGTGACGAAATATAACATATATCTAGACATTTTTTTGAGTATAGATACATCCATATTTAGGCAAATTTGAATCACTTAATATGG
GACGGAGGGAGTACCAAGTTTAGCAATGGTTAACCAAAATTGTAAATTTGTATCGGTGTTTATGGTTGGCCAAAAGCACCTAGTGTCCACCCAAGACTGAAATTAAAATTGATACATGGC
AGAACACAGGAGATGGTCGTTTTATCTGGAGCACACACAATTGGAGGTAAAGGATTCGGGAATCCAAATGTTTTTGACAACTCCTATTTCAAAGTACTCCTTGAGAAGCCACGGCCCACT
TCAT
GTAAGTGATTGTGATATTATCATCACGCCCTTTAAATCCCTGTAAATCATATCTTGATGTAATGCACTGTGCTCTTTTTCTTTGTGAAGCCGGCATGCCGATAGGGCTGCCCACAG
ATTGGGCACTCACTGAAGACGATGAGTGCTTAAG
GTATTCTCTAGAAGCAGACGATCAGCTTTTCATAACATTCGATTGCCCATAGTGACGTTTAAAAATCTAGGCCAAATGGACTTTTA
GCCTTTTTATTTGCATATTAAATTACATCAGTGTTCAGCTTACTGACATTGGAGATACCAAACTGCTTGCAGATGGATCAATATATATGCAGAGGACCAGGCTAAATTTTTCGCCGATTT
CCAAGATGCATACACCAAGCTTGTAAATAGCGGAGCCTCCTGGAGAACAGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGAGCTCACCAACATCCCCCATCTCGCCTCCTCCTCCAACTTCTTCTTCTCCAGCTGCAGTCGCTGTTCCTGCAGGGGCAGAAGAACCGAGAAGGCGGTGATAGCAGTGTCTGTTGCTG
GAATTAGGTGCGGTGCTGATTCTGCATGTTCAGAAATCACTGAGCAGCAAAATCTAGATTCCCTTCCAG
GTTCTAAAAATTCCCGCTGTTACAGAAGGAGAGACTTTGCTGCTGCTGCTC
TGATCCCTTTTCTACTTCCTCGTGTTGATATGGCAAGTGC
GGCTGAGTCATATGATGCATCAATTATTCAAAATGGTGCGAGGAATGTTTTATCCAAGGTCAAAGCTGCTGGCGTGCTTC
GTTTGGTTTTCCATGATGCAGGGACTTTTGATGTTGCTGAAAAATCAG
GTGGCATGAATGGCTCTATAATTTATGAAGTTGACAGACCTGAAAATGCTGGACTAAGTAAATCTTTAAAGA
TACTGCAAAAAGCAAAAGAAGGAATCGATCAAATTCAGAAAG
TATCATGGGCAGACTTGATTGCGGTGGCTGGTGCCGAGGCAGTTGCACTCTGTGGAGGGCCTGAAATTCCAGTAAGAC
TAGGCCGATTAGATTCCAG
CATTGCTGATCCTGTTGGCAAACTTCCTGAAGAAACATTGGATGCTGTTGCCTTGAAAACATCATTCAGAAACAAGGGTTTTTCAACACAGGAGATGGTCG
TTTTATCTGGAGCACACACAATTGGAGGTAAAGGATTCGGGAATCCAAATGTTTTTGACAACTCCTATTTCAAAGTACTCCTTGAGAAGCCACGGCCCACTTCAT
CCGGCATGCCGATAG
GGCTGCCCACAGATTGGGCACTCACTGAAGACGATGAGTGCTTAAG
ATGGATCAATATATATGCAGAGGACCAGGCTAAATTTTTCGCCGATTTCCAAGATGCATACACCAAGCTTGTAA
ATAGCGGAGCCTCCTGGAGAACAGCTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AACCACACAA GGGCATGGAT AGCAAGGTAC AGATTGGCTG ACTAGTGAGT TGTGTCTTTT TTCCTATTTC GTTTCAGTGC AGTAGAAGCC ATTACTGCAT TCAAACAAGG CAAGTAGGAA  GAAGGATGGA GCTCACCAAC ATCCCCCATC TCGCCTCCTC CTCCAACTTC TTCTTCTCCA GCTGCAGTCG CTGTTCCTGC AGGGGCAGAA GAACCGAGAA GGCGGTGATA GCAGTGTCTG  TTGCTGGAAT TAGGTGCGGT GCTGATTCTG CATGTTCAGA AATCACTGAG CAGCAAAATC TAGATTCCCT TCCAGGTTCT AAAAATTCCC GCTGTTACAG AAGGAGAGAC TTTGCTGCTG  CTGCTCTGAT CCCTTTTCTA CTTCCTCGTG TTGATATGGC AAGTGCGGCT GAGTCATATG ATGCATCAAT TATTCAAAAT GGTGCGAGGA ATGTTTTATC CAAGGTCAAA GCTGCTGGCG  TGCTTCGTTT GGTTTTCCAT GATGCAGGGA CTTTTGATGT TGCTGAAAAA TCAGGTGGCA TGAATGGCTC TATAATTTAT GAAGTTGACA GACCTGAAAA TGCTGGACTA AGTAAATCTT  TAAAGATACT GCAAAAAGCA AAAGAAGGAA TCGATCAAAT TCAGAAAGTA TCATGGGCAG ACTTGATTGC GGTGGCTGGT GCCGAGGCAG TTGCACTCTG TGGAGGGCCT GAAATTCCAG  TAAGACTAGG CCGATTAGAT TCCAGCATTG CTGATCCTGT TGGCAAACTT CCTGAAGAAA CATTGGATGC TGTTGCCTTG AAAACATCAT TCAGAAACAA GGGTTTTTCA ACACAGGAGA  TGGTCGTTTT ATCTGGAGCA CACACAATTG GAGGTAAAGG ATTCGGGAAT CCAAATGTTT TTGACAACTC CTATTTCAAA GTACTCCTTG AGAAGCCACG GCCCACTTCA TCCGGCATGC  CGATAGGGCT GCCCACAGAT TGGGCACTCA CTGAAGACGA TGAGTGCTTA AGATGGATCA ATATATATGC AGAGGACCAG GCTAAATTTT TCGCCGATTT CCAAGATGCA TACACCAAGC  TTGTAAATAG CGGAGCCTCC TGGAGAACAG CTTAATCAGA TTTACCATGT TTGTATAAGA TTCGGTCAAA AAAAATTGTC CACACCTTGG TGTTTGCGCA TTATTTACTG ATGAAGTGGC 
TCGTTTGGTA ATGGGAACTT ATATGAATCT TCAGAAAACA GAACATGCTC GTTTGGACTA ACAAACGGCT GAATAAAACT AAAAGCATCG AGTTTATTTT AC 

Retrieve as FASTA