Entry information : AlyPrxII03 (AlyPrxIIC)
Entry ID 7472
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2010-08-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyPrxII03 (AlyPrxIIC)
Name (synonym) AlyPrxII03 (AlyPrxIIC)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrxII03
start..stop
S start..stop
AtPrxII03 328 1.21e-117 1..162 1..162
AtPrxII04 324 4.36e-116 1..162 1..162
AlyPrxII02 317 2.18e-113 1..162 1..162
AtPrxII02 315 1.29e-112 1..162 1..162
Gene structure Fichier Exons


exon

Literature and cross-references AlyPrxII03 (AlyPrxIIC)
DNA ref. Phytozome 12:   scaffold_2 (10562403..10561710)
Protein sequence: AlyPrxII03 (AlyPrxIIC)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   162
PWM (Da):   %s   17288.94  
PI (pH):   %s   5.63
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPITVGDVVPNGTISFFDENDQLQTVSVHSIAAGKKVILFGVPGAFTPTCSMSHVPGFIGKAEELKSKGIDEIICFVNDPFVMKAWGKTYPENKHVKFVADGSGEYTHLLGLELDLKDK
GLGIRSRRFALLLDNLKVTVANVESGGEFTVSSAEDILKAL

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, 2 introns).
DNA
Send to BLAST
CDS
Send to BLAST