Entry information : AlyPrxII06 (AlyPrxIIF)
Entry ID 7475
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2010-08-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyPrxII06 (AlyPrxIIF)
Name (synonym) AlyPrxII06 (AlyPrxIIF)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrxII06
start..stop
S start..stop
AtPrxII06 405 5.18e-147 1..201 1..201
TsPrxII06 391 2.15e-141 1..201 1..201
ThasPrxII03 363 4.02e-130 1..201 1..201
CclPrxII05 319 1.61e-112 1..201 24..224
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7475' 'complement(join(2409145..2409250,2409341..2409435,2409878..2410036,2410130..2410159,2410246..2410461))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2410246..2410461 214 N° 2 2410130..2410159 28 N° 3 2409878..2410036 157 N° 4 2409341..2409435 93
N° 5 2409145..2409250 104  
complement(join(2409145..2409250,2409341..2409435,2409878..2410036,2410130..2410 159,2410246..2410461))


exon

Literature and cross-references AlyPrxII06 (AlyPrxIIF)
DNA ref. Phytozome 12:   scaffold_3 (2410461..2409145)
Protein sequence: AlyPrxII06 (AlyPrxIIF)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   201 (318)
PWM (Da):   %s   21321.03 (34421.1)  
PI (pH):   %s   9.35 (5.25) Peptide Signal:   %s   cut: 21 range:21-338
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAMSILKLRNLSALRSAANSARIGVSSRGFSKLAEGTDITSAAPG
VSLQKARSWDEGVSSKFSTTPLSDIFK
GKKVVIFGLPGAYTGVCSQQHVPSYKSHIDKFKAKGIDSVVCVSVNDPYAINGWAEKLGAKDAIEFYGDFDGKFHKSLGLDKDLSAALLGPRSERWSAYVEDGKVKAVNVEEAPSDFKVT
GAEVILGQI

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 4 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATGTCAATTCTAAAGCTAAGAAATTTATCGGCTTTAAGATCGGCCGCAAATAGTGCCCGGATCGGAGTTTCCTCGAGGGGTTTCTCAAAGCTTGCGGAGGGCACTGACATAACC
TCGGCGGCTCCCGGCGTCTCTCTCCAGAAAGCTCGGAGCTGGGACGAAGGCGTTTCCTCCAAATTCTCCACCACACCATTGTCAGATATCTTCAAG
GTTCGATTCTCTCTTTTCGGACAA
TTTCAATTCAGAGGGGAATTTCAATTTCTGACAAAACGTTTGTGGATATTGATTGGTTACAGGGGGGAAGAAAGTCGTCATTTTTGGACTCCCTGTAAGAAAATTTCTATCCTTTCATCT
TCCTCTATGTCTTGATCATGTTTCTGAGTTCTGATGTTGTGCCGGAATATCTGTTTTCTGTGTGCAGGGGGGGCTTACACGGGAGTTTGTTCGCAGCAGCATGTGCCTAGCTACAAGAGC
CACATTGATAAGTTTAAGGCTAAAGGCATTGATTCTGTCGTATGTGTCTCTGTTAATGATCCCTATGCTATCAATGGTTGGGCTGAGAAGCTTGGTGCCAAAGATGCA
GTAAGTTCATCC
ATGTTTAGTGTCTGCTGGTTTGGTTATTTGCTTCAGAAAACTTGATTTTGAAACATGATATTATATTATCCGGTTCCTGGTTTTGTTGTCTAAGAGTTTTTGAGTGGTGAAGATGGATCA
TTTAGGAATCTTTTAACTCCTTTTGGTATGTAGCTCTTGTTGACGTCCTGATAGTAATCTACCTCTTATAGTTAGGACTATTACTCTATTATTTCACATCATCTATGGTCTCAAGCTTAC
ATTCACATCAATAGACGATAAAAAAGATTTGATACTATGATTAACTTGACAACCCTTGTTATTTTATTAGAAAATTCATAATTCTTGATATGGACTAGCATTACAATATATTTCTATGTT
TATGTTCGGATAGTGTTACATGCTAGAACTAATGACTTAATGTGATGCTCTTAAACTTTTGTCATACCAGATATTGAGTTTTATGGGGATTTTGATGGGAAATTCCACAAAAGCTTGGGG
CTAGACAAGGATCTCTCTGCTGCATTACTCGGGCCACGGTCTGAGAG
GTAATACACTGCAAAGTCCATTTGTAGAAATGTTTGTATCGTGAACCATTGATCTAACAGATTCGTTGGAATT
ATGATGTCCATGTTCAGATATGGTCGGCTTATGTAGAAGACGGTAAGGTTAAGGCGGTGAATGTGGAAGAAGCACCGTCTGACTTCAAGGTTACAGGGGCAGAAGTCATCTTAGGACAGA
TCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATGTCAATTCTAAAGCTAAGAAATTTATCGGCTTTAAGATCGGCCGCAAATAGTGCCCGGATCGGAGTTTCCTCGAGGGGTTTCTCAAAGCTTGCGGAGGGCACTGACATAACC
TCGGCGGCTCCCGGCGTCTCTCTCCAGAAAGCTCGGAGCTGGGACGAAGGCGTTTCCTCCAAATTCTCCACCACACCATTGTCAGATATCTTCAAG
GGGAAGAAAGTCGTCATTTTTGGA
CTCCCT
GGGGCTTACACGGGAGTTTGTTCGCAGCAGCATGTGCCTAGCTACAAGAGCCACATTGATAAGTTTAAGGCTAAAGGCATTGATTCTGTCGTATGTGTCTCTGTTAATGATCCC
TATGCTATCAATGGTTGGGCTGAGAAGCTTGGTGCCAAAGATGCA
ATTGAGTTTTATGGGGATTTTGATGGGAAATTCCACAAAAGCTTGGGGCTAGACAAGGATCTCTCTGCTGCATTA
CTCGGGCCACGGTCTGAGAG
ATGGTCGGCTTATGTAGAAGACGGTAAGGTTAAGGCGGTGAATGTGGAAGAAGCACCGTCTGACTTCAAGGTTACAGGGGCAGAAGTCATCTTAGGACAG
ATCTAA

Retrieve as FASTA