Entry information : ZmPrx52(Zm00001d047358 / GRMZM2G149273 / peroxidase K)
Entry ID 748
Creation 2005-12-09 (Christophe Dunand)
Last sequence changes 2005-12-09 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2022-12-31 (Christophe Dunand)
Peroxidase information: ZmPrx52(Zm00001d047358 / GRMZM2G149273 / peroxidase K)
Name ZmPrx52(Zm00001d047358 / GRMZM2G149273 / peroxidase K)
Class Class III peroxidase    [Orthogroup: Prx199]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx52
start..stop
S start..stop
SbPrx13 555 0 1..318 1..320
OsPrx127 427 5.48e-152 16..317 19..317
TaPrx221-1B 405 2.69e-143 20..317 19..319
TaPrx221-1A 405 4.76e-143 20..317 19..319
Gene structure Fichier Exons


exon

Literature and cross-references ZmPrx52(Zm00001d047358 / GRMZM2G149273 / peroxidase K)
Literature Bohnert,H. et al., NSF Grant DBI-0211842: Functional Genomics of Root Growth and Root Signaling Under Drought. unpublished
Protein ref. UniProtKB:   Q9ZTS6 [Fragment]
DNA ref. GenBank:   AC218903.2 (159343..160556)
Cluster/Prediction ref. UniGene:   Zm.41353
Protein sequence: ZmPrx52(Zm00001d047358 / GRMZM2G149273 / peroxidase K)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (291)
PWM (Da):   %s   34439.38 (31842.9)  
PI (pH):   %s   8.7 (8.54) Peptide Signal:   %s   cut: 28 range:28-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVGKGGGLLVLVVVGLLLHGTRVADAQSLRVGYYSQTCGSAESI
VADEVQKASYRDRGVLASLIRLHFHDCFVN
GCDGSVLLEASDRQAEKNAKPNLSLRGFDVIERIKQRLEAACALTVSCADIVAFAARDSVKLSGGLWYAVPGGRQDGTVSRASMTGDLPPPNQRNVDLLAQYFYRKGLTLDEMVLLSAAH
TVGIAHCSSFDYRLTSDQDKGMDPAFRNSLRSQCQYNPSNYVPLDAGSQYAFDTGYFSNVLANRTVLDSDAALASPRTADKVKQWKNNPDWFKNSFAAAMVKMGSIRGSYPGKVRLNCTR
VRM

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 9, 3 introns) and 6 ESTs (1 unigene and 1 TGI). Also found in AC205898.3.
DNA
Send to BLAST
CDS
Send to BLAST