1. Browse the Database
  2. View Redoxidase
Entry information : AlyPrx33
Entry ID 7485
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2010-08-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-27 (Christophe Dunand)
Peroxidase information: AlyPrx33
Name AlyPrx33
Class Class III peroxidase    [Orthogroup: Prx040]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx33
start..stop		 S start..stop
AhalPrx39 697 0 1..349 1..355
CrubPrx107 676 0 8..349 12..353
AtPrx33 675 0 8..349 13..354
BrPrx34-1Ab_other 657 0 7..349 7..349
Gene structure Fichier Exons►


exon

Literature and cross-references AlyPrx33
DNA ref. Phytozome 12:   scaffold_5 (14156320..14163018)
Protein sequence: AlyPrx33
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   349 (323)
PWM (Da):   %s   38375.33 (35488.9)  
PI (pH):   %s   6.87 (6.88) Peptide Signal:   %s   cut: 27 range:27-349
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQFSSFTWTILITLGCLMLRASLSDAQLTPTFYDTSCPNVTNIVR
DTIVNELRSDPRIAGSILRLHFHDCFVNGCDASILLDNTTSFQTEKDALGNANSARGFPVIDRMKAAVERACPRTVSCADMLTIAAQQSVTLAGGPSWKVSLGRRDSLQAFLNLANANLPAPFF
TLPELKANFKKVGLDRPSDLVALSGAHTFGKNQCRFIMDRLYNFSNTGLPDPTLNTTYLQTLRGQCPRNGNQSVLVDFDLRTPLVFDNKYYVNLKEQKGLIQSDQELFSSPNATDTIPLV
RSFADGTEKFFDAFVEAMNRMGNITPTTGSQGQIRLNCRVVNSNSLLHDVVEIVDFVSSM

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, 3 introns and 5')
DNA ►
Send to BLAST
CDS►
Send to BLAST