Entry information : ZmPrx53 (GRMZM2G063435 [6a])
Entry ID 749
Creation 2009-01-12 (Christophe Dunand)
Last sequence changes 2009-01-12 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-07-01 (Christophe Dunand)
Peroxidase information: ZmPrx53 (GRMZM2G063435 [6a])
Name (synonym) ZmPrx53 (GRMZM2G063435 [6a])
Class Class III peroxidase    [Orthogroup: Prx126]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Anthers
Pollens
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx53
start..stop
S start..stop
ZmPrx132 684 0 1..436 1..441
SbPrx22 624 0 27..441 28..441
SiPrx169 526 0 25..342 23..338
OsPrx36 445 2e-154 27..378 28..382
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 152680639..152680851 213 N° 2 152680959..152682074 1116  
join(152680639..152680851,152680959..152682074)


exon

Literature and cross-references ZmPrx53 (GRMZM2G063435 [6a])
Literature Genoplante, unpublished.
DNA ref. GenBank:   AC191628.3 (113034..114466)
Protein sequence: ZmPrx53 (GRMZM2G063435 [6a])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   442 (418)
PWM (Da):   %s   46388.34 (43898.0) Transmb domain:   %s   i7-24o
PI (pH):   %s   4.67 (4.67) Peptide Signal:   %s   cut: 25 range:25-442
Sequence 483
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDACLRLGFFLLLVAAAFAPLVSAQLSADFYKTSCPDAEKIILGVVEKRFKADPGTAAGLLRLVFHDCFANGCDASILIDPMSNQASEKEAGPNISVKGYDVIEEIKTELEKECPNVVSCADIISVSARDSVKLSGGPEYAVLLGRRDSLVSNREDADNLPGPDIAVPKLIDEFDKQGFNTEEMIAMLGGGHSIGVCRCFFIETDAAPIDEAFKKKISDACDGKDSGSVPMDSTSPNDMDGSYFGLVLEKKMPLTIDRLLGMDKTTEPIVKAMSDKTTDFVPIFAKAMEKLSALKVLTGKDGEIRKTCSEFNNPQNTSGSTSVIRISSIDADQMAGLSQPGSTSRKVGGRADVSTPTAVETPAMAATEAAAKVPGGVVVSAGDQDRSGSGPKLRGSGGPVVNPVPAAPGGAEEAAKQQEVTDLEEKKKRNMAKLRGAGQAKQ

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 9, intron 1) and 89 ESTs. Cultivar="Ohio43", "F2". Also found in AC150182.4.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGACGCCTGTCTCCGCCTCGGCTTCTTCCTCCTCCTCGTGGCCGCGGCGTTCGCGCCGCTGGTCTCCGCGCAGCTCTCGGCAGATTTCTACAAGACGTCGTGCCCCGACGCCGAGAAGA
TCATCTTGGGCGTCGTCGAGAAGCGGTTCAAGGCGGACCCCGGCACGGCCGCCGGCCTCCTCCGCCTCGTCTTCCACGACTGCTTCGCAAAC
GTACGTAAACGACTTGCTAGCCGTCGTC
GACTCGTCGTACGCGCGTTGCTTAGTGGTAGCATGCAATGCATGCAGCGCGTGACTGTATTGTGCGTGTCTCCGTCCAGGGCTGCGACGCGTCCATCTTGATCGACCCCATGTCGAACCA
GGCCTCCGAGAAGGAGGCGGGCCCCAACATCTCCGTCAAGGGCTACGACGTGATCGAGGAGATCAAGACGGAGCTGGAGAAGGAGTGCCCCAACGTGGTGTCGTGCGCGGACATCATCTC
GGTGAGCGCCCGCGACTCGGTGAAGCTGTCGGGAGGGCCCGAATACGCGGTGCTCCTGGGGCGGCGCGACTCGCTCGTGTCCAACCGCGAGGACGCCGACAACCTGCCGGGCCCGGACAT
CGCGGTGCCCAAGCTCATCGACGAGTTCGACAAGCAGGGCTTCAACACGGAGGAGATGATCGCGATGCTGGGCGGCGGCCACAGCATCGGCGTCTGCAGGTGCTTCTTCATCGAGACCGA
CGCCGCGCCCATCGACGAGGCGTTCAAGAAGAAGATCAGCGACGCCTGCGACGGCAAGGACTCGGGCTCCGTCCCCATGGACTCCACCTCGCCCAACGACATGGACGGGAGCTACTTCGG
CCTGGTGCTGGAGAAGAAGATGCCCCTCACCATCGACCGCCTGCTGGGGATGGACAAGACGACGGAGCCCATAGTGAAGGCCATGTCGGACAAGACTACCGACTTCGTCCCCATCTTCGC
CAAGGCCATGGAGAAGCTCAGCGCCCTCAAGGTTCTCACGGGGAAGGACGGCGAGATCAGGAAGACGTGCTCCGAGTTCAACAACCCGCAGAACACCAGCGGCAGCACGTCGGTGATACG
GATCAGCTCCATCGACGCCGACCAGATGGCCGGCCTGTCGCAGCCAGGGTCGACGTCCAGGAAGGTGGGCGGCCGCGCGGATGTCAGCACTCCCACCGCGGTGGAAACGCCCGCCATGGC
GGCCACTGAGGCGGCCGCCAAGGTTCCTGGCGGGGTGGTCGTCAGCGCCGGAGACCAGGATAGGTCCGGCTCCGGCCCGAAGCTCCGCGGCAGCGGGGGACCTGTAGTGAACCCGGTCCC
GGCGGCGCCCGGCGGCGCCGAGGAAGCTGCCAAGCAGCAGGAGGTGACGGACCTGGAGGAGAAGAAGAAGAGGAACATGGCCAAGCTCCGCGGCGCCGGTCAGGCCAAGCAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGACGCCTGTCTCCGCCTCGGCTTCTTCCTCCTCCTCGTGGCCGCGGCGTTCGCGCCGCTGGTCTCCGCGCAGCTCTCGGCAGATTTCTACAAGACGTCGTGCCCCGACGCCGAGAAGA
TCATCTTGGGCGTCGTCGAGAAGCGGTTCAAGGCGGACCCCGGCACGGCCGCCGGCCTCCTCCGCCTCGTCTTCCACGACTGCTTCGCAAAC
GGCTGCGACGCGTCCATCTTGATCGACC
CCATGTCGAACCAGGCCTCCGAGAAGGAGGCGGGCCCCAACATCTCCGTCAAGGGCTACGACGTGATCGAGGAGATCAAGACGGAGCTGGAGAAGGAGTGCCCCAACGTGGTGTCGTGCG
CGGACATCATCTCGGTGAGCGCCCGCGACTCGGTGAAGCTGTCGGGAGGGCCCGAATACGCGGTGCTCCTGGGGCGGCGCGACTCGCTCGTGTCCAACCGCGAGGACGCCGACAACCTGC
CGGGCCCGGACATCGCGGTGCCCAAGCTCATCGACGAGTTCGACAAGCAGGGCTTCAACACGGAGGAGATGATCGCGATGCTGGGCGGCGGCCACAGCATCGGCGTCTGCAGGTGCTTCT
TCATCGAGACCGACGCCGCGCCCATCGACGAGGCGTTCAAGAAGAAGATCAGCGACGCCTGCGACGGCAAGGACTCGGGCTCCGTCCCCATGGACTCCACCTCGCCCAACGACATGGACG
GGAGCTACTTCGGCCTGGTGCTGGAGAAGAAGATGCCCCTCACCATCGACCGCCTGCTGGGGATGGACAAGACGACGGAGCCCATAGTGAAGGCCATGTCGGACAAGACTACCGACTTCG
TCCCCATCTTCGCCAAGGCCATGGAGAAGCTCAGCGCCCTCAAGGTTCTCACGGGGAAGGACGGCGAGATCAGGAAGACGTGCTCCGAGTTCAACAACCCGCAGAACACCAGCGGCAGCA
CGTCGGTGATACGGATCAGCTCCATCGACGCCGACCAGATGGCCGGCCTGTCGCAGCCAGGGTCGACGTCCAGGAAGGTGGGCGGCCGCGCGGATGTCAGCACTCCCACCGCGGTGGAAA
CGCCCGCCATGGCGGCCACTGAGGCGGCCGCCAAGGTTCCTGGCGGGGTGGTCGTCAGCGCCGGAGACCAGGATAGGTCCGGCTCCGGCCCGAAGCTCCGCGGCAGCGGGGGACCTGTAG
TGAACCCGGTCCCGGCGGCGCCCGGCGGCGCCGAGGAAGCTGCCAAGCAGCAGGAGGTGACGGACCTGGAGGAGAAGAAGAAGAGGAACATGGCCAAGCTCCGCGGCGCCGGTCAGGCCA
AGCAGTAG

Retrieve as FASTA