Entry information : ZmPrx54
Entry ID 750
Creation 2005-12-09 (Christophe Dunand)
Last sequence changes 2005-12-09 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-02-10 (Catherine Mathe)
Peroxidase information: ZmPrx54
Name ZmPrx54
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Endosperm
Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx54
start..stop
S start..stop
SbPrx54 617 0 3..341 2..334
SiPrx17 608 0 4..341 3..334
SofPrx04 602 0 24..341 21..334
ZmPrx18 598 0 22..341 19..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 110593..110841 249 N° 2 109848..110039 192 N° 3 109573..109738 166 N° 4 109034..109452 419
complement(join(109034..109452,109573..109738,109848..110039,110593..110841))


exon

Literature and cross-references ZmPrx54
Protein ref. UniProtKB:   B4FK56   B6U5G5 [Other strain]
DNA ref. GenBank:   AC199118.4 (110841..109034)
mRNA ref. GenBank:   BT037494
EST ref. GenBank:   DV502330.1 [5' end]   EE681406.1 [3' end]
Protein sequence: ZmPrx54
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   341 (313)
PWM (Da):   %s   35838.16 (33114.7) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.41 (8.57) Peptide Signal:   %s   cut: 29 range:29-341
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATSSTGCLVLLCLASPLLLLPSAVVLGHPWGVGGGGLSPQFYDHSCPMAEKIVQSVVAQAVAKETRMAASLVRLHFHDCFVKGCDASVLLDNSSSIVSEKGSNPNRNSIRGFEVVDQIKAALEAACPGTVSCADILALAARDSTALVGGPYWDVALGRRDSLGASIQGSNNDIPAPNNTLPTIITKFKRQGLNVADVVALSGGHTIGMSRCTSFRQRLYNQTGNGMADSTLDVSYAARLRQSCPRSGADSTLFPLDVVAPAKFDNFYYKNLLAGRGLLSSDEVLLTKSAETASLVKAYAADAGLFFRHFAQSMVSMGNISPLTGSQGEIRKNCRRLNSGH

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 8, 3 introns) and 5 ESTs. Unigene compile ESTs from ZmPrx18.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAACATCCAGCACGGGCTGTCTCGTCTTGCTCTGCCTTGCGTCTCCCCTCCTCCTCCTTCCCAGTGCGGTGGTCCTTGGCCACCCATGGGGTGTCGGCGGCGGCGGCTTGTCCCCA
CAGTTCTACGACCACTCGTGTCCCATGGCGGAGAAGATTGTGCAGTCCGTTGTGGCGCAGGCTGTGGCCAAGGAGACCAGGATGGCGGCGTCCTTGGTCAGGCTGCATTTCCATGACTGC
TTTGTCAAG
GTACGTTACGTAAACTCTGCCGCCCTCTGATCTGCTTGTGTTCTTCGTTACATGTACATTGCTCTGACGACGACGCAGCTATGAGGCTAGCTTCATGCTGCAGTACACGCG
CTATGACAGGTTAGCGATACAAGAAATCCTACCGTTTCAAACAAACATGAGAAGTTAAGCAAAGATATATGAATGGATGGATGAATCCATTATATTACTAGCTTTGGCCGCTGTATAAAA
CCAGCAACTTGAAATTATATGAATGTTCTGGCTAACCTTCTCTAGTTACTATTGATTGATGAGAAATCCTACCGTTTCCCATGCCACCAGCACTACACTACTCTCTGTGTCCTGGTGACA
TGACCGAGCCAGTACACTGACTGATTAACTATGTTGCTCTCCTTTTTCGAGTGCTACTCCACAAGATGTCCTCGGCCTCTCTCTCTCTCTCTCTTTGTTGCGACCCACACGAGAAGATGT
TTTACTTAACTCTAGTGCACAATGATTGAAGCTCCTCTGTACTAGCGTGTGCCCTGCCTAATCTCTTTCGCAAAATGTGTAGGGCTGCGACGCTTCGGTGCTGCTGGACAACAGCAGCAG
CATCGTTAGTGAGAAAGGGTCCAACCCGAACAGGAACTCCATCAGGGGGTTCGAGGTGGTAGACCAGATCAAGGCTGCTCTCGAGGCTGCCTGCCCGGGCACAGTCTCCTGCGCCGACAT
TCTCGCCCTCGCCGCTCGTGATTCCACCGCCCTG
GTACGTGATCAGCAGCCCTGTGACCCTGTCCATCCTTAAGGCTCACCATAGCTTTGGCAAAGTGAGATCTTTTTTTTTTCTTCCCT
CAACTCTAACCTGCGTAGCGTAGGTTGGTGGCCCATACTGGGACGTGGCGCTTGGGCGGAGGGACTCGCTGGGCGCAAGCATCCAGGGCTCCAACAATGACATCCCAGCCCCCAACAACA
CGCTCCCCACCATCATCACCAAGTTCAAGCGCCAGGGCCTCAATGTCGCTGATGTCGTTGCCCTCTCAG
GTGCCTGACTGACTGACTGACTGACTCTACCATCTGTTGTCCTTCGTTACT
GACCAACGACTTGACGTACACTCATGTCACACACACAACACCGTCACCATGCAATGCATGCATATGCAGGCGGTCACACCATAGGCATGTCTCGGTGCACCAGTTTCCGGCAGAGGCTGT
ACAACCAGACAGGCAACGGCATGGCCGACAGCACGCTGGACGTGTCCTACGCCGCGCGGCTGAGGCAGAGCTGCCCCCGCTCTGGCGCCGACAGCACCCTCTTCCCCCTGGACGTCGTCG
CCCCAGCCAAGTTCGACAACTTCTACTACAAGAACCTCCTGGCCGGCAGGGGCCTTCTCAGCTCCGACGAGGTTCTGTTGACCAAGAGCGCCGAGACGGCGTCCCTCGTCAAGGCGTATG
CCGCCGACGCCGGTCTCTTCTTCCGCCACTTTGCGCAGTCCATGGTCAGTATGGGCAACATCTCGCCGCTCACTGGGTCACAAGGTGAGATCAGGAAGAACTGCAGGAGGCTCAACAGCG
GCCACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAACATCCAGCACGGGCTGTCTCGTCTTGCTCTGCCTTGCGTCTCCCCTCCTCCTCCTTCCCAGTGCGGTGGTCCTTGGCCACCCATGGGGTGTCGGCGGCGGCGGCTTGTCCCCA
CAGTTCTACGACCACTCGTGTCCCATGGCGGAGAAGATTGTGCAGTCCGTTGTGGCGCAGGCTGTGGCCAAGGAGACCAGGATGGCGGCGTCCTTGGTCAGGCTGCATTTCCATGACTGC
TTTGTCAAG
GGCTGCGACGCTTCGGTGCTGCTGGACAACAGCAGCAGCATCGTTAGTGAGAAAGGGTCCAACCCGAACAGGAACTCCATCAGGGGGTTCGAGGTGGTAGACCAGATCAAG
GCTGCTCTCGAGGCTGCCTGCCCGGGCACAGTCTCCTGCGCCGACATTCTCGCCCTCGCCGCTCGTGATTCCACCGCCCTG
GTTGGTGGCCCATACTGGGACGTGGCGCTTGGGCGGAGG
GACTCGCTGGGCGCAAGCATCCAGGGCTCCAACAATGACATCCCAGCCCCCAACAACACGCTCCCCACCATCATCACCAAGTTCAAGCGCCAGGGCCTCAATGTCGCTGATGTCGTTGCC
CTCTCAG
GCGGTCACACCATAGGCATGTCTCGGTGCACCAGTTTCCGGCAGAGGCTGTACAACCAGACAGGCAACGGCATGGCCGACAGCACGCTGGACGTGTCCTACGCCGCGCGGCTG
AGGCAGAGCTGCCCCCGCTCTGGCGCCGACAGCACCCTCTTCCCCCTGGACGTCGTCGCCCCAGCCAAGTTCGACAACTTCTACTACAAGAACCTCCTGGCCGGCAGGGGCCTTCTCAGC
TCCGACGAGGTTCTGTTGACCAAGAGCGCCGAGACGGCGTCCCTCGTCAAGGCGTATGCCGCCGACGCCGGTCTCTTCTTCCGCCACTTTGCGCAGTCCATGGTCAGTATGGGCAACATC
TCGCCGCTCACTGGGTCACAAGGTGAGATCAGGAAGAACTGCAGGAGGCTCAACAGCGGCCACTGA

Retrieve as FASTA