Entry information : ZmPrx55(Zm00001d029604 / GRMZM2G020523 [6a] / Peroxidase2)
Entry ID 751
Creation 2007-11-12 (Christophe Dunand)
Last sequence changes 2016-02-01 (Achraf Jemmat)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2023-01-02 (Christophe Dunand)
Peroxidase information: ZmPrx55(Zm00001d029604 / GRMZM2G020523 [6a] / Peroxidase2)
Name ZmPrx55(Zm00001d029604 / GRMZM2G020523 [6a] / Peroxidase2)
Class Class III peroxidase    [Orthogroup: Prx136]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type Seedlings
Inducer Cold stress
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx55
start..stop
S start..stop
ZmPrx41 661 0 1..342 1..349
SbPrx14 564 0 3..342 1..344
SiPrx157 538 0 10..342 1..330
OsPrx4849 489 1.33e-175 26..342 23..335
Gene structure Fichier Exons


exon

Literature and cross-references ZmPrx55(Zm00001d029604 / GRMZM2G020523 [6a] / Peroxidase2)
Literature Wilson,R.K.Direct Submission. Submitted (31-JAN-2008) Genome Sequencing Center, Washington University School of Medicine, 4444 Forest Park Parkway, St. Louis, MO 63108, USA.
Protein ref. GenBank:   ACG40622.1 UniProtKB:   B6TU39
DNA ref. GenBank:   AC217124.5 (112743..115715)
mRNA ref. GenBank:   EU968504
EST ref. GenBank:   DV529352 [5' end]  CO526849 [3' end]
Cluster/Prediction ref. UniGene:   Zm.97530
Protein sequence: ZmPrx55(Zm00001d029604 / GRMZM2G020523 [6a] / Peroxidase2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   342 (300)
PWM (Da):   %s   34827.13 (30565.0)  
PI (pH):   %s   4.67 (4.63) Peptide Signal:   %s   cut: 43 range:43-342
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPMTPLECDMAPAASRQSWPLPRCGLLVLALALATTAAVGSAQLS
SESYYDASCPAALLTIRTAVSTAVLLEPRMGASLLRLHFHDCFVQ
GCDASVLLDDTASFTGEKGAGPNAGSLRGFDVIDNIKMLLELLCPQTVSCADILAVAARDSVAQLGGPSWAVPLGRRDATTASASLANSDLPGPTSSLNGLLNAFSNKGLSSTDMVALSG
AHTVGRAQCKNCRARIYNDTDIDASFAASLRASCPAQAGAGDGALEPLDGSTPDAFDNAYFGNLLSQRGLLHSDQALFGGGGGGATDGLVSAYASNAGQWGADFAAAMVKMGSISPLTGT
DGEIRVNCRRVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (Chromo 1, 3 Introns) and 33 ESTs (ZmPrx41 and ZmPrx55 have been compiled together). Also found in AC206326.3. Strain="B73" and "hybrid".
DNA
Send to BLAST
CDS
Send to BLAST