Entry information : AlyAPx07
Entry ID 7514
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2011-11-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-11-23 (Christophe Dunand)
Peroxidase information: AlyAPx07
Name AlyAPx07
Class Ascorbate peroxidase    [Orthogroup: APx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyAPx07
start..stop
S start..stop
AtAPx07 635 0 1..329 1..349
BstrAPx07 632 0 1..329 1..348
NoffAPx18 617 0 1..329 1..347
NoffAPx09 617 0 1..329 1..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 17775333..17775431 99 N° 2 17775743..17775830 88 N° 3 17775912..17776012 101 N° 4 17776095..17776135 41
N° 5 17776207..17776337 131 N° 6 17776428..17776534 107 N° 7 17776612..17776749 138 N° 8 17776843..17776977 135
N° 9 17777063..17777173 111  
join(17775333..17775431,17775743..17775830,17775912..17776012,17776095..17776135 ,17776207..17776337,17776428..17776534,17776612..17776749,17776843..17776977,177 77063..17777173)


exon

Literature and cross-references AlyAPx07
DNA ref. Phytozome 12:   scaffold_6 (17775333..17777173)
Protein sequence: AlyAPx07
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329
PWM (Da):   %s   35571.23  
PI (pH):   %s   7.56
Sequence 370
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGGVSFLSTVPSFTNTTNHQHLTTLSSSSAFHRRDVLKLTGTAMGMELIGNGFINHVGDANAADLNQRRQRSELQSKIKITLSSAIKAKPELLPSILKLALNDAMTYDKATKSGGANGSIRFSSELSRAENEGLSDGLSLIEDVKKEIDSISKGGPISYADLIQLAGQSAVKSTFLASAIRKCGGNEEKGNLLYTAYGSAGQWGLFDRNFGRSDATEADSEGRVPQWGKATVQEMKDKFIAIGLGPRQLAVMSAFLGPDQLATEQLLATDPQVAPWVQKYQRSRETVSQTDYEVDLITAFTKLSCLGQQINFEAYTYPVERINLSKLKL

Retrieve as FASTA  
Remarks complete sequence from genomic (chromo 6, 8 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGGAGGAGTCTCCTTCCTCTCCACTGTTCCTTCCTTCACCAACACAACCAATCATCAACATCTCACTACACTCTCTTCTTCTTCTTCTCATCGCTCTGTGAGTTTCCAACCATTTCACA
TTCTTTTCTTTCTTGTCTTAACAATTATATTCTGATTTTGAAATTTTGTTTGATCTCTAATCAGGCTGTCATAAGATGTTGCAAGATTGACCCTCAAGTTTCCGGAGAAAGTTTAAGCTT
TCCACCGCCGTGATGTTCTCAAACTCACCGGCACTGCCATGGGAATGGTACATTAACCCTTTACTCAAAATCAAATTACTTAAAACTTTGGTCTAAATGAGACATTGTAATGTATAATCT
TCATGTCAACATTTGATGAGTTTTTGGCAGTGATGATCTCTCTTGTTAGGAATTAATAGGCAATGGTTTCATTAATCATGTGGGTGATGCAAATGCTGCTGATTTGAATCAACGTAGACA
ACGATCCGAGCTTCAAT
GTGAGTTCTAAAACAAGAACACAAGTGTAGTACCAAGAGGTTGTTGTTATTGACATTATAGATTTCATGTTTATTATGCAGCAAAGATCAAGATTACGCTTTC
GAGTGCCATTAAGGCTAAACCGGAGCTTTTACCTTCCATACTCAAACTAGCTCTCAATGATGCAATGACTTATGATAAG
GTCAGGCTTCATATAATTATCTTATCCATCTCTTTGAAGTG
GTTGCACAACTCTTTACCATTAATGCTGGCTTTTTGTATAGGCTACAAAGTCCGGGGGAGCCAATGGATCCATTCGGTTCAGGTATATGATCTAAGAACATTATAAGTGTAATCTTTACA
TGATGTCTCATTCAATATTTTCATTTTGTGAAGCTCTGAGCTAAGTAGAGCAGAGAACGAGGGACTTTCTGATGGGTTGAGTCTGATAGAGGATGTGAAGAAGGAGATTGACTCGATCTC
GAAGGGAGGGCCTATTTCATATGCAGATCTCATTCAATTGGCAG
GTGATGATGTTATAGCATATACCAAAAACATGTTCATCAACAGCATTATTATTGTGGTAACTGAAATCTTTCTTGG
GTTGGTTTCTATAGGACAATCAGCGGTCAAGTCTACGTTTTTAGCATCGGCAATCCGCAAATGTGGTGGAAATGAAGAAAAAGGGAACTTACTCTACACAGCATATGGTTCTGCTGGTCA
G
GTAAACAATGCTATCTTATGTGTTTTGAGTCGCGGAGTATTGTTCAAATCGAGACTGAACCGTTGTGAATCTGTTAGTGGGGCTTGTTTGATAGAAATTTCGGAAGAAGTGATGCAACT
GAGGCAGATTCAGAAGGCAGAGTCCCACAGTGGGGTAAAGCAACTGTGCAAGAGATGAAAGATAAGTTCATTGCCATTGGATTGGGTCCTCGTCAG
GTACATGATTATGGGTTTCAAAAT
ACGGTTATCGGATTTGATCATTCAAAGTAACTAACCTGTATTCGAATCAATGTTTTGAGGGATTTGTAGCTAGCTGTAATGTCTGCATTCTTGGGTCCTGATCAACTAGCAACAGAACAG
CTCTTGGCTACTGACCCGCAAGTTGCTCCATGGGTTCAAAAGTACCAAAGAAGCCGTGAAACCGTATCTCAGACAGATTACGAG
GTTTGTTTGCACTCGATTTGGCCTAATCATATATTC
ATCTACTTCAAACTCAAGCTCATGTTTTGGTTTATGAACATGTTTGCAGGTTGATCTAATAACAGCATTCACAAAGCTAAGTTGCTTAGGACAACAAATCAACTTCGAGGCATACACATA
TCCTGTCGAACGGATCAATCTGAGCAAACTCAAGCTATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGGAGGAGTCTCCTTCCTCTCCACTGTTCCTTCCTTCACCAACACAACCAATCATCAACATCTCACTACACTCTCTTCTTCTTCTTCTCATCGCTCTGAATTAATAGGCAATGGTTTCA
TTAATCATGTGGGTGATGCAAATGCTGCTGATTTGAATCAACGTAGACAACGATCCGAGCTTCAAT
CAAAGATCAAGATTACGCTTTCGAGTGCCATTAAGGCTAAACCGGAGCTTTTAC
CTTCCATACTCAAACTAGCTCTCAATGATGCAATGACTTATGATAAG
GCTACAAAGTCCGGGGGAGCCAATGGATCCATTCGGTTCAGCTCTGAGCTAAGTAGAGCAGAGAACGAGGGAC
TTTCTGATGGGTTGAGTCTGATAGAGGATGTGAAGAAGGAGATTGACTCGATCTCGAAGGGAGGGCCTATTTCATATGCAGATCTCATTCAATTGGCAG
GACAATCAGCGGTCAAGTCTA
CGTTTTTAGCATCGGCAATCCGCAAATGTGGTGGAAATGAAGAAAAAGGGAACTTACTCTACACAGCATATGGTTCTGCTGGTCAG
TGGGGCTTGTTTGATAGAAATTTCGGAAGAAGTG
ATGCAACTGAGGCAGATTCAGAAGGCAGAGTCCCACAGTGGGGTAAAGCAACTGTGCAAGAGATGAAAGATAAGTTCATTGCCATTGGATTGGGTCCTCGTCAG
CTAGCTGTAATGTCTG
CATTCTTGGGTCCTGATCAACTAGCAACAGAACAGCTCTTGGCTACTGACCCGCAAGTTGCTCCATGGGTTCAAAAGTACCAAAGAAGCCGTGAAACCGTATCTCAGACAGATTACGAG
G
TTGATCTAATAACAGCATTCACAAAGCTAAGTTGCTTAGGACAACAAATCAACTTCGAGGCATACACATATCCTGTCGAACGGATCAATCTGAGCAAACTCAAGCTATGA

Retrieve as FASTA