Entry information : AlyAPx03
Entry ID 7519
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2010-08-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyAPx03
Name AlyAPx03
Class Ascorbate peroxidase    [Orthogroup: APx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyAPx03
start..stop
S start..stop
AhalAPx01 590 0 1..287 1..287
AtAPx03 579 0 1..287 1..287
BstrAPx03 544 0 1..287 1..287
CagraAPx03-1 544 0 1..287 1..287
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2551562..2551674 113 N° 2 2551815..2551939 125 N° 3 2552299..2552348 50 N° 4 2552859..2552924 66
N° 5 2553010..2553058 49 N° 6 2553171..2553253 83 N° 7 2553348..2553427 80 N° 8 2553560..2553662 103
N° 9 2554074..2554268 195  
join(2551562..2551674,2551815..2551939,2552299..2552348,2552859..2552924,2553010 ..2553058,2553171..2553253,2553348..2553427,2553560..2553662,2554074..2554268)


exon

Literature and cross-references AlyAPx03
DNA ref. Phytozome 12:   scaffold_7 (2551562..2554268)
Protein sequence: AlyAPx03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   287
PWM (Da):   %s   31323.08 Transmb domain:   %s   o258-280i
PI (pH):   %s   6.8
Sequence 328
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAPIVDAEYLKAITKARRDLRSLIANKNCAPIMLRLAWHDAGTYDAQSKTGGPNGSIRNEEEFTHGANSGLKIALDLCEGVKAKNPKITYADLYQLAGVVAVEVTGGPDIVFVPGRKDSNVSPKEGRLPDAKQGFQHLRDVFYRMGLSDKDIVALSGGHTLGRAHPERSGFDGPWTQEPLKFDNSYFVELLKGESEGLLKLPTDKTLLEDPEFRRLVELYAKDEDAFFRDYAESHKKLSELGFNPNSSAGKAVADSTILAQSAFGVAVAAAVVAFGYFYEIRKRMK

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, 8 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCGGCACCGATTGTTGACGCTGAGTACTTGAAGGCGATCACCAAGGCTCGCCGTGACCTCCGTTCTCTCATCGCGAACAAGAACTGTGCTCCGATCATGCTCCGATTGGCGTAAGTTT
CGATTTCCTTGGTTTTTCGTCGCTTCGCTTGTGTTTCGACTGCGACGGATTTCGTTTGTGTTTCTGTTGAAATCACTCGATTTTGTTTGTTTTTTGACTGTTGAAATGTTGTATCATCTG
GTTTTTGTGAAGATGGCACGATGCTGGAACCTATGATGCTCAATCGAAGACCGGTGGACCTAATGGCTCTATCAGGAACGAAGAAGAGTTCACTCATGGTGCCAACAGTGGTTTGAAGAT
CGCTCTCGATCTCTGTG
GTAGGATTCGTTTTCTGGATAATTTTTCCTCCGCTGCGCTTGCTTTGTTTCATGTTTCATATGTCATGAAATATTACTCTCTATACGCAGGCTTAGTGTGTAC
TGTTGATTTTTCATTGGCACAATTTCTTGATTTACTTACTTGCATTGATTTTAGTTGACTTGTTGTTGTTGTTGTTGTTAGTCTGTGCTTTAGATTACTCGTGAATTTTGGATCTGCCGA
TACTGTGTTCTCATGTGATGTATCCGATTCATGTTGTGGTTTAAGAACACTGTTCAAAATAATTTCATTATGCTTTTGGAAATCGTCGTTGAATTGTTTCGTTATGAGATCTGAGATCTT
ATCTTTGATGTTTCAGAGGGCGTGAAAGCTAAAAATCCCAAAATCACATACGCAGACCTGTATCAGGTGAGTTATGGCTGTGAAAGAAATCTTTGTCATTTGTTTTCAAAGTTCGCTGGA
ATTGTATGCTGCTTGTGTCATAACCTCGTCCCAGGTTTTAGCTTGTTTAGTAGACTTAGTTGATAGTTGAGCAGCTGTGTAATTTTGATTTCAGTTTATTGCAACAGGGGAGTGGCAATT
TGTTTCAGGAGATGTTGCTGATTGTGATTTGCTTTACAAAAATCATAGATTGACTATGTTGTTGTTCAAGTAGAACTTTTATCTCTTGCAGTAGTAGCAATATTCAAGTATAATATACAC
ACATAGAATTCAAACTTACAAGAAGGAAATTGTAATGTGGACTGAATAGATGTCACATGTCTATCATCTGTACCTATATCCTGTTTCTACTACTGTTTGTATTGCCGTTTCTCCCTATTA
TATTTGGTCTTATAAGGTAGAGGCTTTATATGTACCAGTTTAATGGCAATTAAGTTTTGAATATGAATAGTTTACTTTTTAAGTATTTTGTTTTAGCTTGCTGGTGTGGTAGCAGTTGAG
GTTACTGGTGGACCTGACATCGTGTTTGTTCCTGGAAGAAAG
GTATATTTTCTCATCTTTTGAGACATTATAACAGCTTTGTTTAACACTAAAGCAAATAAAATTACTGTATGTTTCTTC
TTGATAGGATTCAAATGTCAGCCCCAAGGAAGGAAGACTTCCTGATGCCAAACAAGGTACACTAAATTGTTATATCAATTATAACAAACTTTCATGTTTTCTACTGATATTATAGTCATG
AAATTGGAAAATCCTTTCTATGAATTCACATTGTTTATATCTCTGTAGGTTTCCAACATCTTAGAGATGTCTTCTACCGGATGGGACTATCTGATAAGGATATTGTGGCACTCTCAGGGG
GTCATACTCTG
GTAAATTCATTGGTCACTTACTTAACTTCCGTTTTTTTTTTTTACACAAATGAAAGGTATACGCATGTGCTTATGACCACTTTTGGGTTTTTAGGGAAGGGCTCACCCA
GAGAGGTCAGGCTTCGATGGACCATGGACTCAAGAGCCGCTGAAGTTTGACAACTCCTACTTCGT
GTAATTTTCATTTCTTTATCCTCAGAGATCTTCTTCTTTGTATTTTTAGTCTTTT
CTGGTTGTGTCTCCAAGAAGAAGAAGCAGCAAATTACAGGATCGGTTATCCATGATTATTTACTGTTTTGGTACCAGGGAACTGCTGAAAGGAGAATCAGAGGGCTTGTTGAAACTTCCA
ACTGACAAGACCTTATTGGAAGACCCGGAGTTTCGTCGTCTTGTTGAGCTTTATGCAAAG
GTATAATATACTGGAAATATTCTCTGCCTCTTAGCCATTTGTTTCTTGCGTTGCTATGAT
AGCTGTTGGAACATAACTCGATTTCCTTTATTGACTTCACATTTTCACTGAATCCACAAGCACATACAGAATCACAAACCAAAGTTTCTAGGGTTTTGTTCTAGAGTACCCCACAAATCC
TAATCGCCAATAATAGTTGCTGATGTTGCAAATTGATAAAATGAACACTCTTAGGAATTAGTATCATCCTGTAACGGTGAGAACCTCACAGTCCCTATTTTTCTTCATGTTTGGTGTGGC
TTTAAAATTAGCTTTTGTAAGATAGAAATTCCTTGATTTCCTTGCTTAATTAAGTTTCAATAAGATAAGCAAATGTTGTTGGCTGTTGACAAGTCCAGTGTGTTGTGACAGGATGAAGAT
GCATTCTTCAGAGACTATGCGGAATCGCACAAGAAACTCTCTGAGCTGGGTTTCAACCCGAACTCCTCAGCGGGCAAAGCAGTTGCAGACAGCACGATTCTGGCACAGAGTGCGTTCGGG
GTTGCGGTTGCTGCTGCGGTTGTGGCCTTTGGTTACTTTTACGAGATTCGGAAGAGGATGAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCGGCACCGATTGTTGACGCTGAGTACTTGAAGGCGATCACCAAGGCTCGCCGTGACCTCCGTTCTCTCATCGCGAACAAGAACTGTGCTCCGATCATGCTCCGATTGGCATGGCACG
ATGCTGGAACCTATGATGCTCAATCGAAGACCGGTGGACCTAATGGCTCTATCAGGAACGAAGAAGAGTTCACTCATGGTGCCAACAGTGGTTTGAAGATCGCTCTCGATCTCTGTG
AGG
GCGTGAAAGCTAAAAATCCCAAAATCACATACGCAGACCTGTATCAG
CTTGCTGGTGTGGTAGCAGTTGAGGTTACTGGTGGACCTGACATCGTGTTTGTTCCTGGAAGAAAGGATTCAA
ATGTCAGCCCCAAGGAAGGAAGACTTCCTGATGCCAAACAAG
GTTTCCAACATCTTAGAGATGTCTTCTACCGGATGGGACTATCTGATAAGGATATTGTGGCACTCTCAGGGGGTCATA
CTCTG
GGAAGGGCTCACCCAGAGAGGTCAGGCTTCGATGGACCATGGACTCAAGAGCCGCTGAAGTTTGACAACTCCTACTTCGTGGAACTGCTGAAAGGAGAATCAGAGGGCTTGTTGA
AACTTCCAACTGACAAGACCTTATTGGAAGACCCGGAGTTTCGTCGTCTTGTTGAGCTTTATGCAAAG
GATGAAGATGCATTCTTCAGAGACTATGCGGAATCGCACAAGAAACTCTCTG
AGCTGGGTTTCAACCCGAACTCCTCAGCGGGCAAAGCAGTTGCAGACAGCACGATTCTGGCACAGAGTGCGTTCGGGGTTGCGGTTGCTGCTGCGGTTGTGGCCTTTGGTTACTTTTACG
AGATTCGGAAGAGGATGAAGTAA

Retrieve as FASTA