Entry information : AlyAPx[P]01-1
Entry ID 7521
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2011-01-28 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-01-28 (Christophe Dunand)
Peroxidase information: AlyAPx[P]01-1
Name AlyAPx[P]01-1
Class Ascorbate peroxidase     [Orthogroup: APx001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyAPx[P]01-1
start..stop
S start..stop
AhalAPx02 235 3.16e-80 1..124 41..164
AlyAPx01 234 7.74e-80 1..124 41..164
AtAPx01 233 1.32e-79 1..124 41..164
TparAPx01 229 3.59e-78 1..124 41..164
Gene structure Fichier Exons


exon

Literature and cross-references AlyAPx[P]01-1
DNA ref. Phytozome 12:   scaffold_3 (9847052..9847654)
Protein sequence: AlyAPx[P]01-1
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   123
PWM (Da):   %s   13170.55  
PI (pH):   %s   5.12
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
WHSAGTFDCQSRTGGPFGTMRFDAEQAHGANSGIHIALRLLDPIREQLLTISFADFFQLAGVVAAEXTGGPEIPFYP*REDKPQPPPEGRLPDATKGFDHLRDVFAKQMGFSEKDIVALS
GAHT

Retrieve as FASTA  
Remarks Pseudogene. Sequence from genomic (chromo 3)
DNA
Send to BLAST
CDS
Send to BLAST