1. Browse the Database
  2. View Redoxidase
Entry information : AlyPrx23
Entry ID 7531
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyPrx23
Name AlyPrx23
Class Class III peroxidase    [Orthogroup: Prx047]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx23
start..stop		 S start..stop
AtPrx23 662 0 1..349 1..349
AruPrx23 650 0 1..349 1..349
NoffPrx22-2A 645 0 1..349 1..349
AhalPrx38 644 0 1..349 1..349
Gene structure Fichier Exons►


exon

Literature and cross-references AlyPrx23
DNA ref. Phytozome 12:   scaffold_4 (18644412..18646396)
Protein sequence: AlyPrx23
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   349 (320)
PWM (Da):   %s   38045.11 (35147.7)  
PI (pH):   %s   8.08 (8.20) Peptide Signal:   %s   cut: 30 range:30-349
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGFSPLFSCSAMGALILGCLLLQASNSNAQLRPDFYFRTCPSVFR
IIGDTIVDELRTDPRIAASILRLHFHDCFVRGCDASILLDNSTSFRTEKDAAPNKNSVRGFNVIDRMKSAIERACPRTVSCADMLTIASQISVLLSGGPWWPVPLGRRDSVEAFFNLANTALPSPFSTLTQLKAAFADVGLNRASDLVALSGGHTFGRAQCQFVTPRLYNFNGTNRPDPSLNPTYLVELRQLCPQNGNGTVLVNFDPVTPNAFDRQYYTNLRNGKGLIQSDQVLFSTPGADTTTLVNQYSSNTFAFFGAFVDAMIRMGNLR
PLTGTQGEIRQNCRVVNPRISVVENDDGVVSSI

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 3 introns).
DNA ►
Send to BLAST
CDS►
Send to BLAST