Entry information : AlyPrx07
Entry ID 7535
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyPrx07
Name AlyPrx07
Class Class III peroxidase    [Orthogroup: Prx037]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx07
start..stop
S start..stop
AhalPrx54 629 0 43..349 1..307
AtPrx07 622 0 1..349 1..349
BstrPrx10 616 0 17..349 17..351
CrubPrx42 612 0 17..349 16..352
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13998495..13998782 288 N° 2 13999182..13999943 762  
join(13998495..13998782,13999182..13999943)


exon

Literature and cross-references AlyPrx07
DNA ref. Phytozome 12:   scaffold_1 (13998495..13999943)
Protein sequence: AlyPrx07
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   172 (327)
PWM (Da):   %s   18379.05 (36305.2) Transmb domain:   %s   i5-22o
PI (pH):   %s   4.65 (6.75) Peptide Signal:   %s   cut: 23 range:23-349
Sequence 390
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLAVISVVVLLVILVAWPVSASRKDLPRSGGYGGDDDDDTKSWFPLDNLLSLNYYDRICPDFEKIVDRKVREWTKSDSSLGPALLRLIFHDCGVTGCDASVLLDYEGTERRSSASKSLRGFELIDDIKSEMEKSCPGLVSCADILTSASRAATVQLGGPYWPNVYGRRDSKNSYARDVEKVPSGRRDVTALLETFQSYGLNILDLVVLSGAHTIGKAYCGTIQSRLYNYNATNGSDPSIDPKYADYLRRRCRWASETVELDAVTPAVFDNQYYINLQKHMGVLSTDQELVKDPRTAPLVKAFAEQPPQMFRQQFAVSMAKLVNVGVLTGEDRVGEIRKVCSKSNSRAY

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAAGTTGGCCGTGATCTCAGTCGTCGTCCTACTGGTGATTCTCGTGGCCTGGCCGGTATCGGCTAGCCGGAAAGACTTACCCCGATCGGGAGGATACGGAGGCGATGACGATGATGATA
CAAAGTCATGGTTTCCTTTGGACAATCTATTATCGTTGAATTACTATGATAGGATTTGTCCAGATTTTGAGAAAATCGTTGATAGGAAAGTGAGGGAATGGACTAAGAGTGACTCTTCCC
TTGGTCCCGCCCTCCTCCGCCTTATCTTCCACGACTGTGGTGTCACG
GTATTGCAATTATATCTTCTTCCTTAAATATTTATTTAACATTAATTAATCGTTCAATAATTGCTTAGTAATT
ATTTTAACATTACTTCATGCTGTGTAAGCCAATGTTTTTGATTCATATATGGTTTACATTGTCCTACCAAAAAAAAAAAAATATGGTTTACATTGTTCTAAAATGGGTCTCACTTATTAG
AGGTTGGAATTGTTCTTTCGTCTATCTAGACCATATTTAGAATATTAATAGTCAATAGATATAAGTTTCTTAATATTTTGAAGACGGACTTACGAGATTTATTCTATGCATAAACGCACC
TTAGTGTTTTTGCCCATATCTAATATAGATAAGCATTTCAAAAGATAATAAATTGACTATTTTGTAAATGAATTAACAACTTTCAGGGATGTGATGCGTCTGTTCTTCTAGACTACGAAG
GGACAGAGAGAAGATCTTCGGCGAGCAAAAGCCTAAGAGGCTTCGAGCTAATCGACGATATCAAGTCTGAGATGGAGAAATCTTGCCCCGGATTAGTCTCATGCGCTGACATCCTAACAT
CAGCTAGTCGTGCTGCCACCGTCCAACTCGGTGGTCCTTACTGGCCCAACGTCTACGGTCGTCGTGATTCCAAAAACTCTTACGCTAGAGACGTTGAGAAAGTCCCTTCAGGCCGCCGTG
ATGTTACCGCCCTTCTCGAAACGTTTCAATCGTACGGTCTCAACATCCTCGACCTAGTTGTCCTCTCCGGTGCCCACACCATCGGAAAAGCCTACTGTGGTACCATCCAGTCGAGGCTTT
ACAACTACAACGCAACCAATGGTTCAGATCCGTCGATTGACCCAAAATACGCAGATTACTTGCGACGCAGGTGTCGCTGGGCCTCTGAGACCGTTGAGCTCGACGCCGTAACTCCAGCAG
TGTTCGATAATCAGTACTACATTAATCTTCAGAAGCATATGGGAGTTTTGTCGACTGATCAGGAGCTTGTTAAGGACCCAAGGACAGCTCCACTTGTAAAGGCTTTCGCGGAGCAACCAC
CTCAGATGTTCAGACAACAGTTTGCTGTGTCAATGGCTAAGCTGGTCAATGTTGGTGTCCTCACTGGTGAAGATCGTGTCGGAGAGATCAGGAAGGTTTGCAGCAAATCTAACTCCAGAG
CTTACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAAGTTGGCCGTGATCTCAGTCGTCGTCCTACTGGTGATTCTCGTGGCCTGGCCGGTATCGGCTAGCCGGAAAGACTTACCCCGATCGGGAGGATACGGAGGCGATGACGATGATGATA
CAAAGTCATGGTTTCCTTTGGACAATCTATTATCGTTGAATTACTATGATAGGATTTGTCCAGATTTTGAGAAAATCGTTGATAGGAAAGTGAGGGAATGGACTAAGAGTGACTCTTCCC
TTGGTCCCGCCCTCCTCCGCCTTATCTTCCACGACTGTGGTGTCACG
GGATGTGATGCGTCTGTTCTTCTAGACTACGAAGGGACAGAGAGAAGATCTTCGGCGAGCAAAAGCCTAAGAG
GCTTCGAGCTAATCGACGATATCAAGTCTGAGATGGAGAAATCTTGCCCCGGATTAGTCTCATGCGCTGACATCCTAACATCAGCTAGTCGTGCTGCCACCGTCCAACTCGGTGGTCCTT
ACTGGCCCAACGTCTACGGTCGTCGTGATTCCAAAAACTCTTACGCTAGAGACGTTGAGAAAGTCCCTTCAGGCCGCCGTGATGTTACCGCCCTTCTCGAAACGTTTCAATCGTACGGTC
TCAACATCCTCGACCTAGTTGTCCTCTCCGGTGCCCACACCATCGGAAAAGCCTACTGTGGTACCATCCAGTCGAGGCTTTACAACTACAACGCAACCAATGGTTCAGATCCGTCGATTG
ACCCAAAATACGCAGATTACTTGCGACGCAGGTGTCGCTGGGCCTCTGAGACCGTTGAGCTCGACGCCGTAACTCCAGCAGTGTTCGATAATCAGTACTACATTAATCTTCAGAAGCATA
TGGGAGTTTTGTCGACTGATCAGGAGCTTGTTAAGGACCCAAGGACAGCTCCACTTGTAAAGGCTTTCGCGGAGCAACCACCTCAGATGTTCAGACAACAGTTTGCTGTGTCAATGGCTA
AGCTGGTCAATGTTGGTGTCCTCACTGGTGAAGATCGTGTCGGAGAGATCAGGAAGGTTTGCAGCAAATCTAACTCCAGAGCTTACTAA

Retrieve as FASTA