1. Browse the Database
  2. View Redoxidase
Entry information : AlyPrx34-2
Entry ID 7565
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyPrx34-2
Name AlyPrx34-2
Class Class III peroxidase    [Orthogroup: Prx040]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx34-2
start..stop		 S start..stop
AhalPrx51 721 0 1..355 1..355
BstrPrx03 671 0 6..355 4..353
AruPrx01-1 654 0 6..355 4..353
CrubPrx38 652 0 17..355 19..357
Gene structure Fichier Exons►


exon

Literature and cross-references AlyPrx34-2
DNA ref. Phytozome 12:   scaffold_6 (13087165..13084976)
Protein sequence: AlyPrx34-2
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   355 (323)
PWM (Da):   %s   38778.48 (35410.8) Transmb domain:   %s   o10-32i
PI (pH):   %s   8.14 (8.21) Peptide Signal:   %s   cut: 33 range:33-355
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKFSASSSSTSLTWTTLITLGCLMLYASLSDAQLTPTFYDNSCPN
VTNIVRDTIVNELRSDPRIAASILRLHFHDCFVNGCDASILLDNTTSFRTEKDAFGNANSARGFPVIDRMKAAIETACPRTVSCADMLTIAAQQSVTLAGGPSWRVPLGRRDSLQAFLQLANANLPGPSSTLPQLKDRFKNVGLNRPSDLVALSGGHTFGKNQCRFIMNRLYNFSNTGLPDPSLNTTYLQTLRGLCPRNGNLSALVDFDLRTPTVFDNKYYVNLGERKGLIQSDQELFSSPNATDTIPLVRSYANSTQTFFNAFVEAMNRMGNI
TPLTGTQGQIRLNCRVVNSNSLLHDVVDIVDFVSSM

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, 3 introns).
DNA ►
Send to BLAST
CDS►
Send to BLAST