Entry information : AlyGPx03
Entry ID 7568
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyGPx03
Name AlyGPx03
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyGPx03
start..stop
S start..stop
AtGPx03 410 6.79e-149 1..206 1..206
RsGPx03 308 1e-108 14..206 4..197
BnGPx03_other 305 4.15e-107 14..206 4..197
ThasGPx03 301 6.03e-106 1..206 3..198
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7568' 'complement(join(21192745..21192777,21192864..21193031,21193119..21193237,21193325..21193386,21193613..21193689,21194066..21194227))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 21194066..21194227 160 N° 2 21193613..21193689 75 N° 3 21193325..21193386 60 N° 4 21193119..21193237 117
N° 5 21192864..21193031 166 N° 6 21192745..21192777 31  
complement(join(21192745..21192777,21192864..21193031,21193119..21193237,2119332 5..21193386,21193613..21193689,21194066..21194227))


exon

Literature and cross-references AlyGPx03
DNA ref. Phytozome 12:   scaffold_4 (21194227..21192745)
Protein sequence: AlyGPx03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   206 (302)
PWM (Da):   %s   23160.1 (33127.8) Transmb domain:   %s   i19-36o
PI (pH):   %s   9.71 (8.21) Peptide Signal:   %s   cut: 19 range:19-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPRSSRWVNHRATSKTKKLILFLLVAFVFYLYRYPSSPSTVEQSS
SSIYNVSVK
DIEGKDVSLSKFTGKVLLIVNVASKCGLTHGNYKEMNILYAKYKTGFEILAFPCNQFGSQEPGSNKEIKETVCNIFKAEFPIFDIEVNGKNTCPLYNFLKEQKGGLFGDAIKWNFAKFLV
DRQGNVVDRYAPTTSPLEIE
KDIVKLLASA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTAGATCAAGCAGATGGGTCAATCATCGAGCTACCTCTAAGACTAAAAAATTGATTCTCTTCTTGCTTGTAGCCTTCGTCTTCTACCTCTACAGATACCCTTCTTCTCCATCCACA
GTGGAACAATCATCCAGTTCCATCTACAACGTTTCCGTTAAG
GTATAATCAGCTTAAACTTGGATATTTAGAAGCCAATTGTTCACCCTCTATGTTGGTCTGCGTCGATGTTTGGTTCTG
ATTCTGAAGAATCATTCTAATCGCTGATGTTTATTTATGAAAACTTCATGTTTTACTGCGAATTTAGCTTAAGATACTAAATCTATACGAGTGCTTCATTTGAAGGACTTTGTCTAGCTA
AGATACTGAATCAAGAGGAGTGCATATATTTAGTGTTAGATTAGGAAATGACTTTGTTTTGTGTGTTTTTTTAAGTGAATCTTTCAATGACTATATGCCTCTTAAGTTCATCTTTGTAGT
AACATTATTTATCATAACACCATAACTCCGTATCAAATTTTTCGAATTGAAAATGCAGGAGACATCGAAGGGAAAGATGTGAGTTTGAGCAAGTTCACCGGAAAAGTGCTTCTCATCGTC
AATGTAGCCTCTAAGTG
GTATGCTACTAAGTACTTATTGTTCTTACTCCTGTCTTCACACCAACTCCTAAATCTTCACAAACAGTATTGTTCTACTCGAACCGTTTCATGTGGACGGATT
CTTTTGCATCAACTATACTTTATTTAGGAATAGCGCAACTCCTCAATGGCTTACAGAAGTGTTGCATATAATGTCACATTACATTGGCGTTATATATAAAATCTTGTTGTGATGAATGGG
CAGTGTGGTCTAACACATGGAAACTACAAAGAAATGAACATTTTGTATGCCAAGTACAAAACTCAGGGTGCGTCTCTTTATCTCGCTTAGCCTTTCTCAGGTTAATAACTAATTGAACAT
TTATAAGTATTAAGGGAAGCATCGTTTTACGCAGGGGGTTTGAGATCTTAGCATTTCCTTGCAACCAATTTGGTAGTCAAGAGCCAGGTAGCAACAAGGAGATCAAGGAAACTGTTTGCA
ATATCTTCAAAGCAGAATTCCCAATCTTTGACAAG
GTCTCGCAAACTTTTAAACTAGTCTCAATTTTCATCACACAGTGCCAATTTTGCCTAGTTGTTTACATATCTTTTTTCCAATGCA
AGATATTGAAGTAAATGGAAAGAACACTTGTCCCCTTTACAACTTCTTAAAAGAACAAAAAGGAGGATTGTTTGGGGATGCTATTAAGTGGAATTTCGCTAAATTTCTGGTAGACAGACA
AGGAAATGTCGTGGACCGATATGCTCCAACTACATCACCTCTTGAAATTGAG
GTTAGTAGAAGTTTCCCCTCATACATGATATTCATTTCTCTAATCATTGAGCTTACTCTGTAGTTTTC
TCGCTCTTCTTTTCGCAGAAAAGGACATCGTGAAGCTATTGGCATCTGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTAGATCAAGCAGATGGGTCAATCATCGAGCTACCTCTAAGACTAAAAAATTGATTCTCTTCTTGCTTGTAGCCTTCGTCTTCTACCTCTACAGATACCCTTCTTCTCCATCCACA
GTGGAACAATCATCCAGTTCCATCTACAACGTTTCCGTTAAG
GACATCGAAGGGAAAGATGTGAGTTTGAGCAAGTTCACCGGAAAAGTGCTTCTCATCGTCAATGTAGCCTCTAAGTGT
GGTCTAACACATGGAAACTACAAAGAAATGAACATTTTGTATGCCAAGTACAAAACTCAGG
GGTTTGAGATCTTAGCATTTCCTTGCAACCAATTTGGTAGTCAAGAGCCAGGTAGCAAC
AAGGAGATCAAGGAAACTGTTTGCAATATCTTCAAAGCAGAATTCCCAATCTTTGACAAG
ATTGAAGTAAATGGAAAGAACACTTGTCCCCTTTACAACTTCTTAAAAGAACAAAAAGGA
GGATTGTTTGGGGATGCTATTAAGTGGAATTTCGCTAAATTTCTGGTAGACAGACAAGGAAATGTCGTGGACCGATATGCTCCAACTACATCACCTCTTGAAATTGAG
AAGGACATCGTG
AAGCTATTGGCATCTGCTTGA

Retrieve as FASTA