1. Browse the Database
  2. View Redoxidase
Entry information : AlyGPx04
Entry ID 7569
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyGPx04
Name AlyGPx04
Class Plant glutathione peroxidase    [Orthogroup: Gpx2002]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyGPx04
start..stop		 S start..stop
AtGPx04 348 2.93e-125 1..170 1..170
BnGPx04_other 333 2.28e-119 1..170 1..170
BnGPx05_other 308 1.96e-109 1..169 1..169
BrGPx05_other 306 6.85e-109 1..169 1..169
Gene structure Fichier Exons►


exon

Literature and cross-references AlyGPx04
DNA ref. Phytozome 12:   scaffold_4 (23321568..23322560)
Protein sequence: AlyGPx04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   170 (313)
PWM (Da):   %s   19140.87 (34795.6)  
PI (pH):   %s   9.53 (8.88) Peptide Signal:   %s   cut: 24 range:24-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGASASVPERSVHQFTVKDSSGKDLNLSIYQGKVLLIVNVASKCGFTETNYTQLTELYRKFKDDFEILAFPCNQFLYQEPGTSQDAHEFACTRFKAEYPVFQVRVNGQNAAPLYKFLKASKPTFLGSRIKWNFTKFLVGKDGLVI
DRYGTMVTPLSIEKDIKKALEDA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 5 introns).
DNA ►
Send to BLAST
CDS►
Send to BLAST