Entry information : ZmPrx61
Entry ID 757
Creation 2005-12-09 (Christophe Dunand)
Last sequence changes 2005-12-09 (Christophe Dunand)
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2010-12-23 (Marie Brette (Scipio))
Peroxidase information: ZmPrx61
Name ZmPrx61
Class Class III peroxidase    [Orthogroup: Prx002]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Mixed tissues
Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx61
start..stop
S start..stop
SbPrx65 625 0 17..336 23..343
SofPrx02 616 0 26..336 31..340
SiPrx16 610 0 3..335 9..336
OsPrx17 592 0 1..335 1..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 59973294..59973530 237 N° 2 59973652..59973843 192 N° 3 59974534..59974699 166 N° 4 59974903..59975318 416
join(59973294..59973530,59973652..59973843,59974534..59974699,59974903..59975318 )


exon

Literature and cross-references ZmPrx61
Literature Bohnert,H. et al., unpublished
DNA ref. GenBank:   AC189769.3 (127719..129740)
Cluster/Prediction ref. UniGene:   Zm.125380   Zm.17947
Protein sequence: ZmPrx61
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (316)
PWM (Da):   %s   36010.34 (34045.2)  
PI (pH):   %s   8.33 (8.40) Peptide Signal:   %s   cut: 21 range:21-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASLVPLVVALLLCPSSSLAMASGAGPAQWGKKLDPHFYDQSCPHAQHIVASIVGKAHHQDPRMAASLLRLHFHDCFVKGCDASLLLDSSGSIVSEKRSNPNRDSARGFEVIDEIKAALEAACPATVSCADILALAARDSTVMTGGPGWIVPLGRRDSRGASVQGSNNDIPAPNNTLPTIITKFKLQGLDIVDLVALLGSHTIGDSRCTSFRQRLYNQTGNGLPDFTLDASYAAALRPRCPRSGGDQNLFFLDPVTPFKFDNQYYKNILAYRGLLSSDEVLLTGSGATADLVKLYAANQDIFFQHFARSIVKMGNISPLTGANGEIRKNCRRVNHA

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo ??, 3 introns) and 43 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCATTGGTCCCTCTGGTTGTTGCGCTCCTCTTGTGCCCGTCGTCGTCGCTGGCAATGGCATCCGGCGCCGGCCCTGCGCAGTGGGGGAAGAAGCTGGACCCGCACTTCTACGAC
CAGTCGTGCCCTCACGCGCAGCACATCGTGGCGTCCATCGTGGGGAAGGCGCACCACCAGGACCCCCGCATGGCCGCCTCCCTCCTCCGCCTCCACTTCCACGACTGCTTCGTCAAG
GTA
CGTACCGGCCGGCCCGTAGCGTGGTTTCATTGGCCATTCATCTTCCATTCGATTCTCTGCTGCCTGCCTGCCTGCCTGCTGCACTTGTGTAACACGTGTGCTAGCACGAACTCTGCAGGG
CTGCGACGCTTCGCTGCTGCTGGACAGCAGCGGGTCCATCGTGAGCGAAAAGCGGTCCAACCCCAACCGGGACTCCGCCAGGGGCTTCGAGGTCATCGACGAGATCAAGGCCGCGCTCGA
GGCTGCCTGCCCGGCCACCGTCTCCTGCGCCGACATCCTGGCGCTTGCAGCCCGCGACTCCACCGTCATG
GTGACTACTTTTATCCTCCACCGTCTCATGCATCATCTTTCATGTGTCTA
CTTCTTGCCATCCCATCATGCACATAGCTAGAATTAACAACACAATAATAAATCTTATAGTTCAGTATATTTTCCCCCCTTCGTCGTCCGACCCCATTATTTCATTTCCTCTAGAAAATA
GTGTCGGTGAGAGCGTACCCGCCCGGCCGCGCTTGAAAAAAAGAAGGGAAATTAATATATGGATGGACTTTATACAAGGATCGGCTGCAGTCCCATTTCCACGTCATGTCGATCGCATCA
TTATCTGTAGGCACATGCAAAAACACCTTTAAATTTGTTGTGTGTGCTATTGCGCGCTCTGCTGGGCCCTGCATAAATATGCATGCACTGATATGATATGATGTGGTGCGCTCGTTAAAG
CGGCGCCAATGTATGCTGTTCCAAATTAAAGTTGATGGCATCTCATGCCCATGCACGGGATAATAAAGTTGTATGTACACTAGTGTGTTTACCATCTCCGCCGGCCGATGCAAAACACAG
TACTGCAATACATATGCGGTACTTTGGGCTCACATGCACGAAAGCTAATTAAAAGCCTGTGGGTGTGCTAAACTAAAATTAAACGCGTACATACGGTGTAGACGATCGGAGGTTGCTTTT
CATGGCTGCCAATAACACATACATACAATACATTACACAGACTGGCGGCCCTGGGTGGATCGTGCCGCTGGGGCGGAGGGACTCCCGTGGCGCTAGCGTGCAGGGCTCCAACAACGACAT
CCCTGCTCCCAACAACACTCTCCCCACCATCATCACAAAGTTCAAGCTCCAGGGCCTCGACATCGTCGACCTCGTCGCACTCCTCG
GTACGTACGTATACCTAGCTACTAGTATCCTGCA
CGATTATCTTCTACATGATGCAGCTGGGGCTTTACAGAAGCATCTAGCGTCTTCATGTCACGATCCTGCAAATACAAAGATCACACATATATATACACAATTAACATGGGCTTTGCACAA
CTGTACATACATGACTAATACGTACTCTGCTGAATTTACTCTGGCACAGGTAGCCACACCATCGGCGACTCCCGGTGCACAAGCTTCCGGCAGCGCCTGTACAACCAGACGGGGAACGGC
CTCCCGGACTTCACCCTGGACGCGTCCTACGCGGCCGCGCTACGCCCGCGCTGCCCGCGGTCGGGGGGTGACCAGAACCTCTTCTTCCTCGACCCCGTCACGCCCTTCAAGTTCGACAAC
CAGTACTACAAAAACATCCTCGCCTACCGTGGCCTCCTCAGCTCCGACGAGGTGCTCCTCACCGGCAGCGGAGCCACCGCTGACCTTGTCAAGCTCTACGCCGCCAACCAGGATATCTTC
TTCCAGCACTTCGCGCGCTCCATTGTCAAGATGGGCAACATCTCGCCGCTCACCGGGGCCAATGGCGAGATCAGGAAGAACTGCAGGAGGGTCAACCACGCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCATTGGTCCCTCTGGTTGTTGCGCTCCTCTTGTGCCCGTCGTCGTCGCTGGCAATGGCATCCGGCGCCGGCCCTGCGCAGTGGGGGAAGAAGCTGGACCCGCACTTCTACGAC
CAGTCGTGCCCTCACGCGCAGCACATCGTGGCGTCCATCGTGGGGAAGGCGCACCACCAGGACCCCCGCATGGCCGCCTCCCTCCTCCGCCTCCACTTCCACGACTGCTTCGTCAAG
GGC
TGCGACGCTTCGCTGCTGCTGGACAGCAGCGGGTCCATCGTGAGCGAAAAGCGGTCCAACCCCAACCGGGACTCCGCCAGGGGCTTCGAGGTCATCGACGAGATCAAGGCCGCGCTCGAG
GCTGCCTGCCCGGCCACCGTCTCCTGCGCCGACATCCTGGCGCTTGCAGCCCGCGACTCCACCGTCATG
ACTGGCGGCCCTGGGTGGATCGTGCCGCTGGGGCGGAGGGACTCCCGTGGC
GCTAGCGTGCAGGGCTCCAACAACGACATCCCTGCTCCCAACAACACTCTCCCCACCATCATCACAAAGTTCAAGCTCCAGGGCCTCGACATCGTCGACCTCGTCGCACTCCTCG
GTAGC
CACACCATCGGCGACTCCCGGTGCACAAGCTTCCGGCAGCGCCTGTACAACCAGACGGGGAACGGCCTCCCGGACTTCACCCTGGACGCGTCCTACGCGGCCGCGCTACGCCCGCGCTGC
CCGCGGTCGGGGGGTGACCAGAACCTCTTCTTCCTCGACCCCGTCACGCCCTTCAAGTTCGACAACCAGTACTACAAAAACATCCTCGCCTACCGTGGCCTCCTCAGCTCCGACGAGGTG
CTCCTCACCGGCAGCGGAGCCACCGCTGACCTTGTCAAGCTCTACGCCGCCAACCAGGATATCTTCTTCCAGCACTTCGCGCGCTCCATTGTCAAGATGGGCAACATCTCGCCGCTCACC
GGGGCCAATGGCGAGATCAGGAAGAACTGCAGGAGGGTCAACCACGCCTGA

Retrieve as FASTA