Entry information : AlyGPx08
Entry ID 7570
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyGPx08
Name AlyGPx08
Class Plant glutathione peroxidase    [Orthogroup: Gpx2003]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyGPx08
start..stop
S start..stop
AtGPx08 330 2.09e-118 1..167 1..167
BnGPx08_other 324 7.48e-116 1..166 1..166
ThasGPx08 293 1.14e-103 2..167 6..171
NtGPx08-1A 287 3.52e-101 2..166 5..169
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7570' 'complement(join(854631..854663,854745..854912,854997..855115,855189..855250,855345..855421,855837..855881))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 855837..855881 43 N° 2 855345..855421 75 N° 3 855189..855250 60 N° 4 854997..855115 117
N° 5 854745..854912 166 N° 6 854631..854663 31  
complement(join(854631..854663,854745..854912,854997..855115,855189..855250,8553 45..855421,855837..855881))


exon

Literature and cross-references AlyGPx08
DNA ref. Phytozome 12:   scaffold_2 (855881..854631)
Protein sequence: AlyGPx08
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   167
PWM (Da):   %s   18918.5  
PI (pH):   %s   4.75
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATKEPESVYEISIEDAKGNSLELSQYKDKVLLIVNVASKCGMTNSNYTELNELYSKYKDGLEILAFPCNQFGDEEPGTSDQITDFVCTRFKSEFPIFNIEVNGDNASPLYKFLKKGKWG
IFGDDIQWNFAKFLVDKNGQAVERYYPTTSPITLE
HDIKKLLNIS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, 5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACGAAGGAACCAGAATCTGTTTACGAGATTAGCATCGAGGTGAATAAATTGCTTCAACTTGAATCATCGATTCAATAACACTCTTTGATAACTTGGGTTTGTGATTTTTTGTTA
AAAGGAAGCACCTTTGATATTATAGGGTTCTAAGGATGGGAAAAGATTTTACTTTAAGGTGTCTTGGATGGGAAGGAATTTGATATGTTTACATTGTCTGAAGTAACGATTTGTCTTTTG
TTGTATCTAGATGTTTGGTTTAAGATTGCTTAGGTTTTGCTTTTCTCACTAGAATCAATTAGATCATGATGGACCATGTTATCAGTTTGATCCTTGCTTTGTCTTCTTCTGTTGATTGGT
CTCTCACATTTTGTTTTCTATAGTCTTTGATTGATTTCTTGTGTTGGCCTCTGAGGCTTTAGCTGAATAATCGTGATATCTCTTCTTCTTCCTGTAACAGGAGATGCTAAGGGAAACAGC
TTAGAACTCAGTCAATACAAAGACAAAGTTCTTTTGATTGTCAATGTTGCTTCCAAATG
GTTAGTTTTTACTCCTTCTATTAAGCTTCTTTCTTTTGCAAATTTGTCGAAAATGTTTGTG
TCTTGTCTTGTTTATACTCTCTGATGGTCTCAGTGTGGGATGACAAACTCAAACTACACCGAATTGAATGAGCTTTATAGCAAGTACAAAGACAAAGGTACATAGTGATTTCAACAACAA
ATTTCTAAGTCCACGCTATTAGCTTCTCCATTGACGTTGTTCTGTTTCAGGTGTCTGGAGATTCTAGCATTTCCTTGTAACCAGTTTGGTGACGAGGAACCGGGAACTAGTGACCAAATC
ACTGACTTTGTTTGTACTCGCTTCAAATCTGAATTCCCCATTTTCAACAAG
GTATAGATCAACTCGATGAATTCACTACAATTCTCTATGTCCTGAAGTTTTTAAAACATTCGTATATGT
CCCGTTGTGTATTAGATATTGAAGTAAACGGAGATAATGCTTCTCCTCTGTATAAGTTCTTAAAGAAAGGCAAATGGGGAATCTTCGGCGATGACATTCAGTGGAACTTTGCTAAGTTTC
TTGTTGACAAGAACGGTCAAGCTGTAGAACGATATTATCCAACTACTTCCCCTATTACTCTTGAG
GTAAAGAAACAATCTCTCTCTCTCTCTCTCACTCTTTCATTCACTCTCTCTGCTA
ATTTTCCTGTCTCAATTTTTCTGCAGCACATGACATAAAGAAGCTTCTGAATATCTCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACGAAGGAACCAGAATCTGTTTACGAGATTAGCATCGAGGATGCTAAGGGAAACAGCTTAGAACTCAGTCAATACAAAGACAAAGTTCTTTTGATTGTCAATGTTGCTTCCAAA
TG
TGGGATGACAAACTCAAACTACACCGAATTGAATGAGCTTTATAGCAAGTACAAAGACAAAGGTCTGGAGATTCTAGCATTTCCTTGTAACCAGTTTGGTGACGAGGAACCGGGAACT
AGTGACCAAATCACTGACTTTGTTTGTACTCGCTTCAAATCTGAATTCCCCATTTTCAACAAG
ATTGAAGTAAACGGAGATAATGCTTCTCCTCTGTATAAGTTCTTAAAGAAAGGCAAA
TGGGGAATCTTCGGCGATGACATTCAGTGGAACTTTGCTAAGTTTCTTGTTGACAAGAACGGTCAAGCTGTAGAACGATATTATCCAACTACTTCCCCTATTACTCTTGAG
CATGACATA
AAGAAGCTTCTGAATATCTCCTGA

Retrieve as FASTA