Entry information : ZmPrx62
Entry ID 758
Creation 2005-12-09 (Christophe Dunand)
Last sequence changes 2010-12-23 (Marie Brette (Scipio))
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2010-12-23 (Marie Brette (Scipio))
Peroxidase information: ZmPrx62
Name ZmPrx62
Class Class III peroxidase    [Orthogroup: Prx213]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx62
start..stop
S start..stop
ZmPrx14 699 0 1..373 1..373
SbPrx39 324 1e-109 60..371 52..368
SiPrx142 316 4e-107 62..371 15..320
HvPrx64 313 2e-105 35..371 21..356
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 213073081..213073434 354 N° 2 213072169..213072936 768  
complement(join(213072169..213072936,213073081..213073434))


exon

Literature and cross-references ZmPrx62
Literature Bohnert,H., Sharp,R.E., Springer,G.K., Poroyko,V., Fredricksen,M., Sharp,L.G., Spollen,W.G., Ries,J., Guillen,A., Khambati,A., Topinka,C., Davis,G.E., Schachtman,D., Wu,Y. and Nguyen,H.T. NSF Grant DBI-0211842: Functional Genomics of Root Growth and Root Signaling Under Drought.
DNA ref. GenBank:   AC210308.1 (119119..120381)
Protein sequence: ZmPrx62
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   373 (352)
PWM (Da):   %s   40222.06 (38095.8)  
PI (pH):   %s   7.84 (7.62) Peptide Signal:   %s   cut: 22 range:22-373
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKVAALTITLLGLLVSVTCQGSIYSAQQQQDASSSSSSPGCILRGWIPFLHPCRDGQPPTPNPLPPPSGAGLTVGYYKNCPGAEGIVRKAVEKAMDNGNRGIGAGLIRIFFHDCFVRGCDASVLLRNTSGSSDQTEMFGLPNINSLRGFQVINDAKAELEKACPRTVSCADIVAFAARDATRNLSYGAIDFQMPAGRLDGRVSLKEEAEKNLPGPFDSLDDLQKSFAAQGLGFNDMVTLSGAHSIGVARCRFFTNRLPPNPSDMDRDLARSLKATCDQNGLDSKVVQDPVTPVALDNQYYKNVHNGKVLFTSDAALNSTDDARKVVDGFANNAVDWYRAFADAMVKMGNIRDRTINRPKPEIREKCFIYNTY*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, intron 1) and 8 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAAGGTTGCCGCCCTGACGATCACCTTGCTCGGGCTCCTGGTGTCCGTGACATGCCAGGGCAGCATTTACTCTGCTCAGCAGCAGCAGGATGCTTCGTCGTCGTCGTCTAGCCCT
GGCTGCATTCTTCGAGGGTGGATCCCATTCTTGCATCCTTGCCGCGACGGCCAACCCCCAACGCCAAACCCTCTCCCTCCTCCCTCAGGGGCAGGGCTCACCGTGGGCTACTACAAGAAC
TGCCCTGGCGCTGAAGGTATCGTGAGGAAGGCCGTGGAGAAGGCCATGGACAACGGAAACCGCGGCATTGGCGCAGGACTCATTCGTATCTTCTTCCATGACTGCTTTGTTCGG
GTACGC
ACGTCATCTCTCATCTCATCTTATATGGGATACATGCTGCAATGCAAGGCAACTAGCAATGTGGATGATATATGACGACGTGCACGCCGCGTGCTGCACTGCTGCGTGGCTGTTACTATT
GCATGCTTCCATTTCCAGGGTTGCGATGCTTCCGTTCTCCTGAGGAACACCAGCGGCTCCAGCGACCAGACGGAGATGTTCGGCCTGCCCAACATAAACAGCCTCCGCGGGTTCCAGGTC
ATCAACGACGCCAAGGCCGAGCTCGAGAAGGCATGCCCCCGCACGGTGTCATGCGCGGACATCGTCGCCTTCGCCGCACGCGACGCCACGCGCAACCTCAGCTACGGCGCCATCGACTTC
CAGATGCCGGCGGGCCGCCTGGACGGCCGCGTGTCCCTCAAGGAGGAGGCCGAGAAGAACCTCCCGGGGCCGTTCGACAGCCTCGACGACCTCCAGAAGAGCTTCGCGGCCCAGGGCCTC
GGCTTCAACGATATGGTCACGCTCTCCGGTGCGCACAGCATCGGCGTGGCCCGCTGCAGGTTCTTCACCAACCGCCTGCCGCCTAACCCCTCGGACATGGACCGCGACCTCGCCAGGAGC
CTAAAGGCGACCTGCGACCAAAACGGACTCGACTCCAAGGTGGTACAGGACCCCGTGACGCCAGTTGCCCTGGACAACCAGTACTATAAGAACGTGCACAACGGCAAGGTGCTCTTCACG
TCGGACGCCGCGCTCAACTCCACGGACGACGCAAGGAAGGTGGTGGACGGCTTCGCCAACAACGCGGTAGACTGGTACCGCGCGTTCGCCGATGCCATGGTGAAGATGGGCAACATCAGG
GATAGGACCATCAACAGACCCAAGCCCGAGATCAGGGAGAAGTGCTTCATTTACAATACCTACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAAGGTTGCCGCCCTGACGATCACCTTGCTCGGGCTCCTGGTGTCCGTGACATGCCAGGGCAGCATTTACTCTGCTCAGCAGCAGCAGGATGCTTCGTCGTCGTCGTCTAGCCCT
GGCTGCATTCTTCGAGGGTGGATCCCATTCTTGCATCCTTGCCGCGACGGCCAACCCCCAACGCCAAACCCTCTCCCTCCTCCCTCAGGGGCAGGGCTCACCGTGGGCTACTACAAGAAC
TGCCCTGGCGCTGAAGGTATCGTGAGGAAGGCCGTGGAGAAGGCCATGGACAACGGAAACCGCGGCATTGGCGCAGGACTCATTCGTATCTTCTTCCATGACTGCTTTGTTCGG
GGTTGC
GATGCTTCCGTTCTCCTGAGGAACACCAGCGGCTCCAGCGACCAGACGGAGATGTTCGGCCTGCCCAACATAAACAGCCTCCGCGGGTTCCAGGTCATCAACGACGCCAAGGCCGAGCTC
GAGAAGGCATGCCCCCGCACGGTGTCATGCGCGGACATCGTCGCCTTCGCCGCACGCGACGCCACGCGCAACCTCAGCTACGGCGCCATCGACTTCCAGATGCCGGCGGGCCGCCTGGAC
GGCCGCGTGTCCCTCAAGGAGGAGGCCGAGAAGAACCTCCCGGGGCCGTTCGACAGCCTCGACGACCTCCAGAAGAGCTTCGCGGCCCAGGGCCTCGGCTTCAACGATATGGTCACGCTC
TCCGGTGCGCACAGCATCGGCGTGGCCCGCTGCAGGTTCTTCACCAACCGCCTGCCGCCTAACCCCTCGGACATGGACCGCGACCTCGCCAGGAGCCTAAAGGCGACCTGCGACCAAAAC
GGACTCGACTCCAAGGTGGTACAGGACCCCGTGACGCCAGTTGCCCTGGACAACCAGTACTATAAGAACGTGCACAACGGCAAGGTGCTCTTCACGTCGGACGCCGCGCTCAACTCCACG
GACGACGCAAGGAAGGTGGTGGACGGCTTCGCCAACAACGCGGTAGACTGGTACCGCGCGTTCGCCGATGCCATGGTGAAGATGGGCAACATCAGGGATAGGACCATCAACAGACCCAAG
CCCGAGATCAGGGAGAAGTGCTTCATTTACAATACCTACTGA

Retrieve as FASTA