1. Browse the Database
  2. View Redoxidase
Entry information : Ab1CysPrx_bisporus
Entry ID 7587
Creation 2010-08-16 (Christophe Dunand)
Last sequence changes 2012-04-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-10 (Christophe Dunand)
Peroxidase information: Ab1CysPrx_bisporus
Name Ab1CysPrx_bisporus
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Agaricaceae Agaricus
Organism Agaricus bisporus    [TaxId: 5341 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Ab1CysPrx_bisporus
start..stop		 S start..stop
Pc1CysPrx01 385 1.86e-138 1..221 1..221
Lbi1CysPrx 384 4.59e-138 1..221 1..221
Athi1CysPrx01 384 1.01e-137 1..221 1..221
Pcar1CysPrx01 384 1.04e-137 1..221 1..221
Gene structure Fichier Exons►


exon

Literature and cross-references Ab1CysPrx_bisporus
DNA ref. JGI genome:   scaffold_4 (813356..814339)
Protein sequence: Ab1CysPrx_bisporus
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   221
PWM (Da):   %s   24902.8 Transmb domain:   %s   o367-389i449-471o509-531i544-566o581-599i733-750o
PI (pH):   %s   6.61
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSLRLGDTAPDFEAETTTGNIKFHEWIGNSWAILFSHPGDFTPVCTTELGEVARRAPDFQKRDVKLIGISANGLEDHHAWVKDINEYGSKFGHTDVRFPIIADGDRKISTLYDMLDYQD
ATNRDAKGLPFTIRTVFVIDPKKTIRLMIAYPASTGRNFDEIIRYVLSLQLGDKHRITTPVNWNKGDDVIVHPSVTSEEAKVLFPEHTVHPYLRTTPLKV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4).
DNA ►
Send to BLAST
CDS►
Send to BLAST