Entry information : ZmPrx63(Zm00001d022279 / GRMZM2G427903)
Entry ID 759
Creation 2005-12-09 (Christophe Dunand)
Last sequence changes 2005-12-09 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2023-01-04 (Christophe Dunand)
Peroxidase information: ZmPrx63(Zm00001d022279 / GRMZM2G427903)
Name ZmPrx63(Zm00001d022279 / GRMZM2G427903)
Class Class III peroxidase    [Orthogroup: Prx089]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx63
start..stop
S start..stop
ZmPrx68 695 0 1..351 1..380
SbPrx35 518 0 49..351 113..413
ZmPrx08 429 1.39e-151 17..349 16..349
SiPrx116 427 4.19e-151 50..351 46..333
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '759' 'join(168791897..168792178,168792296..168793069)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 168791897..168792178 280 N° 2 168792296..168793069 772  
join(168791897..168792178,168792296..168793069)


exon

Literature and cross-references ZmPrx63(Zm00001d022279 / GRMZM2G427903)
Literature Bohnert,H. et al., unpublished
DNA ref. GenBank:   AC206295.2 (8261..9377)
Cluster/Prediction ref. UniGene:   Zm.21449
Protein sequence: ZmPrx63(Zm00001d022279 / GRMZM2G427903)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   351 (330)
PWM (Da):   %s   36543.17 (34492.0)  
PI (pH):   %s   5.71 (5.35) Peptide Signal:   %s   cut: 22 range:22-351
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATKLAVLGTLVLALLGPVSCQQQQAGYGYGAGSPTPTTSPPPPP
PAAGAGLSVGYYKDKCAEAETIVQEAVRAADAGTKAGLLRLFFHDCFVQ
GCDASVLLKPDNDTNPQPEMLGVPNLSLRGFEVIDAAKAAVEARCPGVVSCADIVAFAGRDASAFLSGGAINFTMPAGRYDGTVSLANETLPNLPPPFADVRRLKAMFAAKGLDTVDMVA
LSGAHSIGRSHCSSFSSDRLPPSNTSDMDPAFAATLQASCASSANGAADNTVVQDYRTPDQLDNQYYRNVISHKVLFASDAALLKSSDTLGLVYVAAFSQKLWQDKFGEAMVKMGGVQVK
TAANGEIRRMCGYVNKP*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, intron 1) and 6 ESTs. Contig contains 6 other peroxidases.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACCAAGCTCGCCGTTCTCGGCACCTTGGTGCTCGCGCTGCTCGGCCCCGTGTCGTGCCAACAACAGCAAGCGGGCTACGGCTATGGCGCCGGCAGTCCTACACCTACTACATCG
CCGCCGCCGCCGCCACCTGCCGCTGGTGCCGGACTGAGCGTAGGATACTACAAGGACAAGTGCGCCGAGGCAGAAACCATCGTGCAGGAGGCCGTGCGCGCTGCCGACGCCGGCACCAAA
GCAGGGCTCCTCCGTTTGTTCTTCCACGACTGCTTCGTCCAG
AGGTATTATATACTCCGTACTATAAACCATGCATGTGACTATGTGAGTGTGACACCCTCGTCGTGTGACGTGTCTGCA
TGTGTCCAACAATGTGTCGTACTTACGTATGGCGTTCACAGGGCTGCGACGCCTCCGTTCTGCTCAAGCCCGACAACGACACCAACCCGCAGCCGGAGATGCTCGGGGTCCCCAACCTGA
GCCTGCGCGGCTTCGAGGTCATCGACGCGGCCAAGGCGGCGGTCGAGGCGAGATGCCCGGGCGTCGTGTCCTGCGCCGACATCGTCGCCTTCGCCGGCCGCGACGCCAGCGCGTTCCTCA
GCGGCGGCGCCATCAACTTCACCATGCCCGCGGGCCGCTACGACGGGACGGTGTCGCTCGCCAACGAGACGCTCCCCAACCTGCCCCCGCCGTTCGCCGACGTCCGGCGCCTCAAGGCCA
TGTTCGCCGCCAAGGGCCTCGACACCGTCGACATGGTCGCGCTCTCCGGCGCGCACAGCATCGGCCGCTCCCACTGCTCCTCCTTCAGCAGCGACCGCCTCCCGCCCAGCAACACCTCCG
ACATGGACCCGGCGTTCGCCGCCACGCTGCAGGCGAGCTGCGCGTCGTCGGCCAACGGCGCTGCCGACAACACGGTGGTGCAGGACTACAGGACCCCTGACCAGCTGGACAACCAGTACT
ACCGGAACGTCATCAGCCACAAGGTGCTCTTCGCGTCGGATGCCGCACTCCTCAAGTCAAGCGACACGCTTGGGCTGGTCTATGTAGCCGCCTTCTCTCAGAAGCTGTGGCAGGACAAGT
TTGGAGAAGCCATGGTGAAGATGGGTGGCGTCCAGGTGAAGACGGCCGCCAATGGGGAGATCAGACGGATGTGTGGCTACGTCAACAAACCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACCAAGCTCGCCGTTCTCGGCACCTTGGTGCTCGCGCTGCTCGGCCCCGTGTCGTGCCAACAACAGCAAGCGGGCTACGGCTATGGCGCCGGCAGTCCTACACCTACTACATCG
CCGCCGCCGCCGCCACCTGCCGCTGGTGCCGGACTGAGCGTAGGATACTACAAGGACAAGTGCGCCGAGGCAGAAACCATCGTGCAGGAGGCCGTGCGCGCTGCCGACGCCGGCACCAAA
GCAGGGCTCCTCCGTTTGTTCTTCCACGACTGCTTCGTCCAG
GGCTGCGACGCCTCCGTTCTGCTCAAGCCCGACAACGACACCAACCCGCAGCCGGAGATGCTCGGGGTCCCCAACCTG
AGCCTGCGCGGCTTCGAGGTCATCGACGCGGCCAAGGCGGCGGTCGAGGCGAGATGCCCGGGCGTCGTGTCCTGCGCCGACATCGTCGCCTTCGCCGGCCGCGACGCCAGCGCGTTCCTC
AGCGGCGGCGCCATCAACTTCACCATGCCCGCGGGCCGCTACGACGGGACGGTGTCGCTCGCCAACGAGACGCTCCCCAACCTGCCCCCGCCGTTCGCCGACGTCCGGCGCCTCAAGGCC
ATGTTCGCCGCCAAGGGCCTCGACACCGTCGACATGGTCGCGCTCTCCGGCGCGCACAGCATCGGCCGCTCCCACTGCTCCTCCTTCAGCAGCGACCGCCTCCCGCCCAGCAACACCTCC
GACATGGACCCGGCGTTCGCCGCCACGCTGCAGGCGAGCTGCGCGTCGTCGGCCAACGGCGCTGCCGACAACACGGTGGTGCAGGACTACAGGACCCCTGACCAGCTGGACAACCAGTAC
TACCGGAACGTCATCAGCCACAAGGTGCTCTTCGCGTCGGATGCCGCACTCCTCAAGTCAAGCGACACGCTTGGGCTGGTCTATGTAGCCGCCTTCTCTCAGAAGCTGTGGCAGGACAAG
TTTGGAGAAGCCATGGTGAAGATGGGTGGCGTCCAGGTGAAGACGGCCGCCAATGGGGAGATCAGACGGATGTGTGGCTACGTCAACAAACCCTAA

Retrieve as FASTA