Entry information : AbHalPrx02_bisporus
Entry ID 7602
Creation 2010-08-17 (Christophe Dunand)
Last sequence changes 2010-08-17 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-04-10 (Christophe Dunand)
Peroxidase information: AbHalPrx02_bisporus
Name AbHalPrx02_bisporus
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Agaricaceae Agaricus
Organism Agaricus bisporus    [TaxId: 5341 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AbHalPrx02_bisporus
start..stop
S start..stop
LbiHalPrx04 321 8.27e-112 11..267 5..251
CcinHalPrx03 296 7.74e-102 20..263 13..260
SbreHalPrx03 228 4.8e-75 20..263 17..247
SlutHalPrx03 224 1.25e-73 20..263 13..243
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7602' 'complement(join(205237..205870,205920..206095))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 205920..206095 174 N° 2 205237..205870 632  
complement(join(205237..205870,205920..206095))


exon

Literature and cross-references AbHalPrx02_bisporus
DNA ref. JGI genome:   scaffold_18 (206095..205237)
Protein sequence: AbHalPrx02_bisporus
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   269 (327)
PWM (Da):   %s   29849.99 (36386.2)  
PI (pH):   %s   6.39 (5.15) Peptide Signal:   %s   cut: 24 range:24-350
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSSLLSNKISLPDAHPPVHEHSSGRCPVADKHDFCPPQSGDSRS
PCPALNTMANHGY
INRDGKNVSAYDIHRGLKACYGLSTPLALFLSYVGFAMLRRARPIDLYQIGKHNVIEHDASLVHHDTPGGEEYAPIKIDEALVEELIEDVSGGHEAAKSEEPTPQSSLMDAVDVARSRVR
REKLSKPLDPVHAEIARGEMAIILGVWEQKSKDKVGVPIDWMKQWLGHERLPDGWRPDHTEGLFDVIRRAKEMRAVMERMQEEEALLSKAS

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTCTTCCCTTCTCTCCAACAAAATATCCCTCCCCGACGCTCACCCTCCTGTGCACGAGCATAGTAGCGGAAGATGTCCCGTTGCTGATAAACACGACTTCTGTCCTCCTCAGTCC
GGTGACAGCCGTTCACCTTGCCCTGCTCTAAATACTATGGCAAATCATGGTTATAT
GTATGTGTTGCCTTTTAATCATAAAATGCCCTTTCCTAAATTCTCGTAGTATAATCGTGATGGA
AAAAATGTTTCGGCGTATGACATCCATCGTGGGTTGAAAGCATGTTACGGGCTTTCAACGCCACTTGCACTCTTCTTGAGCTACGTTGGCTTCGCTATGTTGCGGCGTGCGCGTCCAATC
GACCTTTATCAAATCGGAAAGCACAATGTGATAGAACATGATGCTAGTCTTGTTCATCACGATACTCCCGGAGGGGAAGAATATGCACCAATCAAGATTGATGAGGCGCTTGTAGAAGAG
TTGATCGAAGATGTGAGCGGCGGCCATGAAGCAGCAAAGTCCGAAGAACCGACGCCACAATCGTCGCTCATGGATGCCGTTGATGTGGCACGTTCTCGTGTTAGGCGTGAGAAATTATCT
AAACCTTTGGACCCGGTACATGCAGAAATTGCTCGGGGGGAAATGGCTATCATCCTCGGTGTATGGGAACAAAAGTCGAAAGATAAAGTCGGAGTGCCAATCGATTGGATGAAGCAGTGG
CTTGGCCACGAGCGATTGCCCGATGGTTGGAGACCTGATCACACCGAGGGTTTGTTCGACGTAATCAGACGTGCCAAAGAGATGAGAGCGGTCATGGAAAGGATGCAGGAGGAGGAAGCA
CTTCTATCAAAGGCCTCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTCTTCCCTTCTCTCCAACAAAATATCCCTCCCCGACGCTCACCCTCCTGTGCACGAGCATAGTAGCGGAAGATGTCCCGTTGCTGATAAACACGACTTCTGTCCTCCTCAGTCC
GGTGACAGCCGTTCACCTTGCCCTGCTCTAAATACTATGGCAAATCATGGTTATAT
TAATCGTGATGGAAAAAATGTTTCGGCGTATGACATCCATCGTGGGTTGAAAGCATGTTACGGG
CTTTCAACGCCACTTGCACTCTTCTTGAGCTACGTTGGCTTCGCTATGTTGCGGCGTGCGCGTCCAATCGACCTTTATCAAATCGGAAAGCACAATGTGATAGAACATGATGCTAGTCTT
GTTCATCACGATACTCCCGGAGGGGAAGAATATGCACCAATCAAGATTGATGAGGCGCTTGTAGAAGAGTTGATCGAAGATGTGAGCGGCGGCCATGAAGCAGCAAAGTCCGAAGAACCG
ACGCCACAATCGTCGCTCATGGATGCCGTTGATGTGGCACGTTCTCGTGTTAGGCGTGAGAAATTATCTAAACCTTTGGACCCGGTACATGCAGAAATTGCTCGGGGGGAAATGGCTATC
ATCCTCGGTGTATGGGAACAAAAGTCGAAAGATAAAGTCGGAGTGCCAATCGATTGGATGAAGCAGTGGCTTGGCCACGAGCGATTGCCCGATGGTTGGAGACCTGATCACACCGAGGGT
TTGTTCGACGTAATCAGACGTGCCAAAGAGATGAGAGCGGTCATGGAAAGGATGCAGGAGGAGGAAGCACTTCTATCAAAGGCCTCGTGA

Retrieve as FASTA