Entry information : CcinFRe03
Entry ID 7603
Creation 2010-08-17 (Christophe Dunand)
Last sequence changes 2010-08-17 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2012-03-02 (Catherine Mathe)
Peroxidase information: CcinFRe03
Name CcinFRe03
Class Ferric Reductase    [Orthogroup: FRe003]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Psathyrellaceae Coprinopsis
Organism Coprinopsis cinerea (Coprinus cinereus)    [TaxId: 5346 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CcinFRe03
start..stop
S start..stop
CcinFRe04 744 0 14..674 12..711
CcinFRe01 632 0 158..674 11..522
CcinFRe02 592 0 158..674 45..537
PcFRe01 162 4.1e-42 153..674 184..753
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7603' 'complement(join(1849224..1850786,1850924..1851250,1851379..1851513))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1851379..1851513 133 N° 2 1850924..1851250 325 N° 3 1849224..1850786 1561  
complement(join(1849224..1850786,1850924..1851250,1851379..1851513))


exon

Literature and cross-references CcinFRe03
DNA ref. JGI genome:   Chr_9 (1851513..1849224)
Protein sequence: CcinFRe03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   674 (640)
PWM (Da):   %s   74561.1 (70935.2) Transmb domain:   %s   o15-37i198-217o252-274i287-309o319-341i348-370o380-397i550-572o (i164-183o218-240i253-275o285-307i314-336o346-363i516-538o)
PI (pH):   %s   8.52 (8.52) Peptide Signal:   %s   cut: 35 range:35-674
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMITSSSGLEPMVSLTRLFLLALTLAQLFTSTTAVRGQGIIGAGKQGCSILLRTLALCIEEHCRRDNPQISKIERFWETYPLAGTGVFLDPAQVGPIMSYQEALRYAHVDVEEFGEGNIPSVVAWEPLNATSLVRAEDWLVIYNGLLLLNTGGLVSPWAACLVQS
LGDLPRKPFIGYRHRTPVAANIGFMPTRGQTLYIIYLVVTQITLAILPLNFFKPWGYMSPPYFSQRLLEYLYSHPALQILGDRTGVIAMADFVALFLFSSRNNILLWITDWSHGTFILLH
RWVGYCTIIQTCMHSLLLLILYGKDHEYQSHRKFWVWGIVGTLAFVILWPASLLPVRQRCHEFFLISHQVLSVIALVGTFLHIYIFYGYRWGFEIWVYVGGTIWFLDRFIRVLRMFANGY
RTAAITAIDPSGEYLRVEIDGIVAEGHVYLTFPTLGWRFWESHPFSVLSTVTAGRAKVAKGVEDVATSKVAGLDPEKTSRPSSSSSGSGGHSTTVRPRITLLFRPMTGITRTIGQRLSAL
GKGQRLALPVLVESSYHANPATRNLAHCTTLLCIAGGVGITAILPIVRTFGGARARVAWGMRNEWLLRAVESDLAALNPTTVHVETSIGQRLDVVRLLREELMDSEDAGDLGVVVCGPSG
MSDDVRNAVSELGAKAKRGIVFIDEAFGW*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 9, 2 intron)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGATCACTTCCAGCTCTGGCCTAGAGCCTATGGTGTCTCTTACTCGCCTTTTTCTACTCGCGCTCACTCTCGCTCAACTCTTCACATCGACAACGGCTGTTCGAGGTCAAGGGATA
ATTGGTGCAGGGAAA
GTAATCTACGACCTTCCTTGCGCCCACGCTTGTCGTCAAATCATCGCTCCCAGTCCACTCCTATGCGACTCCAAGCTCCCAGGGGAAACCCACACGACGGACCCC
ACCAACCTGACGGAGTGCTATAGCACAAGGATGCAGCATTCTTTTGCGCACTTTGGCCCTCTGTATCGAAGAGCATTGTCGGCGGGACAACCCCCAGATCTCCAAGATCGAGAGGTTTTG
GGAGACCTATCCACTCGCTGGCACCGGCGTTTTCTTGGACCCTGCACAAGTAGGACCGATCATGAGTTACCAGGAGGCACTTCGTTACGCCCATGTAGATGTGGAAGAATTCGGTGAAGG
GAACATCCCGTCTGTCGTGGCCTGGGAACCCTTGAATGCGACGAGCCTCGTCCGCGCAGAGGACTGGCTTGTAATCTACAACGGATTGCTCCTCCTCAACACAGGCGGCCTG
GTTCATGG
GCGAAACGGGTAGGCTTCCCATTCAGAATTTATTTGGAACGGATAAACCTGACCGGGCTTGTTCTTGTTTTACAGGGTCATTGTCGCTGTTACCAGCGTTTTTCTCCCCGTACTCCTTTC
CTTATTGAGGTGTTTCTCCCTGGGCGGCTTGTTTGGTACAGTCGCTTGGTGATCTACCTCGAAAACCGTTCATTGGCTATCGTCATCGCACGCCGGTGGCTGCCAATATCGGTTTCATGC
CGACGCGAGGCCAGACGCTATACATCATCTACCTTGTGGTGACCCAGATCACTCTTGCCATACTCCCCTTAAACTTCTTCAAACCATGGGGCTACATGTCACCGCCCTACTTCTCGCAGC
GCCTTTTGGAGTATCTCTACTCGCACCCTGCTCTGCAAATCCTTGGCGACCGGACGGGCGTCATAGCGATGGCCGACTTTGTCGCTCTTTTCCTTTTTTCCAGCCGCAACAACATCCTTC
TATGGATCACCGATTGGAGCCACGGAACCTTCATTCTCCTTCATCGATGGGTCGGTTACTGCACCATCATCCAAACCTGCATGCACTCCCTCCTCCTCCTCATCTTGTACGGGAAAGACC
ACGAGTACCAGTCTCATCGGAAATTCTGGGTCTGGGGTATCGTTGGCACTCTCGCCTTTGTGATACTCTGGCCGGCGTCCCTCCTCCCCGTTCGCCAGAGATGCCACGAATTCTTCCTCA
TATCCCATCAAGTCCTCTCCGTCATCGCCCTAGTTGGGACCTTCCTTCACATCTACATATTCTATGGCTATAGATGGGGGTTTGAGATATGGGTGTATGTCGGAGGAACCATTTGGTTCC
TCGACCGCTTCATTCGAGTTCTGAGGATGTTCGCGAATGGTTATCGGACAGCAGCCATTACCGCCATCGACCCCAGTGGTGAATACCTCCGCGTCGAGATAGATGGGATCGTTGCGGAAG
GACATGTGTACTTAACCTTCCCCACTCTTGGTTGGAGATTCTGGGAGAGTCATCCCTTCTCCGTGTTATCGACAGTCACAGCGGGTCGAGCAAAGGTCGCTAAAGGTGTCGAAGATGTCG
CTACATCGAAAGTCGCAGGTCTTGACCCGGAGAAAACCAGTCGACCCAGTTCTTCATCGTCAGGCTCGGGTGGTCACTCAACAACCGTTCGTCCACGAATTACCCTCCTTTTCCGCCCAA
TGACTGGTATTACAAGGACGATCGGTCAGCGCTTATCAGCATTGGGCAAGGGGCAGCGCCTGGCCCTTCCAGTTCTGGTCGAGTCGTCGTATCACGCTAATCCAGCTACCCGAAATCTTG
CCCATTGTACCACTTTACTCTGTATTGCGGGCGGTGTAGGCATTACCGCCATTCTCCCAATCGTCAGGACATTCGGAGGCGCTCGTGCTCGAGTTGCGTGGGGAATGCGCAACGAATGGC
TTCTTCGGGCAGTCGAATCCGACCTAGCGGCTCTCAACCCTACCACCGTCCACGTCGAAACAAGTATAGGACAACGGCTGGACGTTGTTCGATTGCTGAGGGAAGAATTGATGGATAGCG
AGGACGCTGGTGATCTGGGCGTGGTTGTGTGTGGTCCGAGTGGAATGTCAGATGATGTACGGAATGCAGTCAGTGAACTCGGAGCGAAGGCAAAGAGGGGAATCGTGTTTATCGACGAGG
CGTTTGGTTGGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGATCACTTCCAGCTCTGGCCTAGAGCCTATGGTGTCTCTTACTCGCCTTTTTCTACTCGCGCTCACTCTCGCTCAACTCTTCACATCGACAACGGCTGTTCGAGGTCAAGGGATA
ATTGGTGCAGGGAAA
CAAGGATGCAGCATTCTTTTGCGCACTTTGGCCCTCTGTATCGAAGAGCATTGTCGGCGGGACAACCCCCAGATCTCCAAGATCGAGAGGTTTTGGGAGACCTAT
CCACTCGCTGGCACCGGCGTTTTCTTGGACCCTGCACAAGTAGGACCGATCATGAGTTACCAGGAGGCACTTCGTTACGCCCATGTAGATGTGGAAGAATTCGGTGAAGGGAACATCCCG
TCTGTCGTGGCCTGGGAACCCTTGAATGCGACGAGCCTCGTCCGCGCAGAGGACTGGCTTGTAATCTACAACGGATTGCTCCTCCTCAACACAGGCGGCCTG
GTTTCTCCCTGGGCGGCT
TGTTTGGTACAGTCGCTTGGTGATCTACCTCGAAAACCGTTCATTGGCTATCGTCATCGCACGCCGGTGGCTGCCAATATCGGTTTCATGCCGACGCGAGGCCAGACGCTATACATCATC
TACCTTGTGGTGACCCAGATCACTCTTGCCATACTCCCCTTAAACTTCTTCAAACCATGGGGCTACATGTCACCGCCCTACTTCTCGCAGCGCCTTTTGGAGTATCTCTACTCGCACCCT
GCTCTGCAAATCCTTGGCGACCGGACGGGCGTCATAGCGATGGCCGACTTTGTCGCTCTTTTCCTTTTTTCCAGCCGCAACAACATCCTTCTATGGATCACCGATTGGAGCCACGGAACC
TTCATTCTCCTTCATCGATGGGTCGGTTACTGCACCATCATCCAAACCTGCATGCACTCCCTCCTCCTCCTCATCTTGTACGGGAAAGACCACGAGTACCAGTCTCATCGGAAATTCTGG
GTCTGGGGTATCGTTGGCACTCTCGCCTTTGTGATACTCTGGCCGGCGTCCCTCCTCCCCGTTCGCCAGAGATGCCACGAATTCTTCCTCATATCCCATCAAGTCCTCTCCGTCATCGCC
CTAGTTGGGACCTTCCTTCACATCTACATATTCTATGGCTATAGATGGGGGTTTGAGATATGGGTGTATGTCGGAGGAACCATTTGGTTCCTCGACCGCTTCATTCGAGTTCTGAGGATG
TTCGCGAATGGTTATCGGACAGCAGCCATTACCGCCATCGACCCCAGTGGTGAATACCTCCGCGTCGAGATAGATGGGATCGTTGCGGAAGGACATGTGTACTTAACCTTCCCCACTCTT
GGTTGGAGATTCTGGGAGAGTCATCCCTTCTCCGTGTTATCGACAGTCACAGCGGGTCGAGCAAAGGTCGCTAAAGGTGTCGAAGATGTCGCTACATCGAAAGTCGCAGGTCTTGACCCG
GAGAAAACCAGTCGACCCAGTTCTTCATCGTCAGGCTCGGGTGGTCACTCAACAACCGTTCGTCCACGAATTACCCTCCTTTTCCGCCCAATGACTGGTATTACAAGGACGATCGGTCAG
CGCTTATCAGCATTGGGCAAGGGGCAGCGCCTGGCCCTTCCAGTTCTGGTCGAGTCGTCGTATCACGCTAATCCAGCTACCCGAAATCTTGCCCATTGTACCACTTTACTCTGTATTGCG
GGCGGTGTAGGCATTACCGCCATTCTCCCAATCGTCAGGACATTCGGAGGCGCTCGTGCTCGAGTTGCGTGGGGAATGCGCAACGAATGGCTTCTTCGGGCAGTCGAATCCGACCTAGCG
GCTCTCAACCCTACCACCGTCCACGTCGAAACAAGTATAGGACAACGGCTGGACGTTGTTCGATTGCTGAGGGAAGAATTGATGGATAGCGAGGACGCTGGTGATCTGGGCGTGGTTGTG
TGTGGTCCGAGTGGAATGTCAGATGATGTACGGAATGCAGTCAGTGAACTCGGAGCGAAGGCAAAGAGGGGAATCGTGTTTATCGACGAGGCGTTTGGTTGGTAA

Retrieve as FASTA