1. Browse the Database
  2. View Redoxidase
Entry information : HcyPrxII
Entry ID 7612
Creation 2010-09-21 (Christophe Dunand)
Last sequence changes 2010-09-21 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: HcyPrxII
Name HcyPrxII
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Hebeloma
Organism Hebeloma cylindrosporum    [TaxId: 76867 ]
Cellular localisation N/D
Tissue type Mycelium
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HcyPrxII
start..stop		 S start..stop
CcinPrxII 261 4.48e-91 2..171 4..171
AthiPrxII 256 4.1e-89 3..171 6..172
LbiPrxII 255 1.35e-88 1..171 1..169
SlutPrxII01 254 5.1e-88 1..171 4..172
Gene structure Fichier Exons►


exon

Literature and cross-references HcyPrxII
Literature Muller,T. and Wipf,D. EST analysis of a Hebeloma cylindrosporum expression cDNA library.
DNA ref. JGI genome:   scaffold_7 (1033565..1032768)
EST ref. GenBank:   EG950094.1
Protein sequence: HcyPrxII
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   171
PWM (Da):   %s   18036.52  
PI (pH):   %s   5.78
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSIKVGDKIPEATFKYVPYTPELENGLACGVPTSLSTNEWKGKKVVIVSVPGAFPTCHVNHLPPFVQKYDEFKAKGVDVVAVVAANDPFVMSGWGRVEGLKDKILSLSDPDAEWSKKLGL
SLDLTGAGLGLGVRTGRYALIIDDLVVKYVGAETGKDVSVSGVDAVLAKL*

Retrieve as FASTA  
Remarks Complete sequence from 4 ESTs.
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST