1. Browse the Database
  2. View Redoxidase
Entry information : Cja1CysPrx01
Entry ID 7628
Creation 2010-10-15 (Myriam Duval)
Last sequence changes 2016-06-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-06-28 (Christophe Dunand)
Peroxidase information: Cja1CysPrx01
Name Cja1CysPrx01
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Metazoa Chordata Mammalia Cebidae Callithrix
Organism Callithrix jacchus (Common marmoset)    [TaxId: 9483 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Cja1CysPrx01
start..stop		 S start..stop
Cja1CysPrx01-1 451 2.2e-164 1..224 1..224
Ptro1CysPrx01-2 446 2.96e-162 1..224 1..224
Ptro1CysPrx01 446 2.96e-162 1..224 1..224
Pabe1CysPrx01 446 2.96e-162 1..224 1..224
Gene structure Fichier Exons►


exon

Literature and cross-references Cja1CysPrx01
DNA ref. GenBank:   NC_013913.1 (33360148..33368971)
Protein sequence: Cja1CysPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   224
PWM (Da):   %s   24775.09 Transmb domain:   %s   o337-359i386-408o423-442i479-501o521-543i704-721o
PI (pH):   %s   5.8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPGGLLLGDVAPNFEANTTVGPIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSDINAYNGEEPTEKLPFPIIDDKNRDLAILLGMLDPAE
KDEKGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 18, 4 introns).
DNA ►
Send to BLAST
CDS►
Send to BLAST