Entry information : CjaPrxV
Entry ID 7631
Creation 2010-10-18 (Myriam Duval)
Last sequence changes 2016-06-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-06-28 (Christophe Dunand)
Peroxidase information: CjaPrxV
Name CjaPrxV
Class Atypical 2-Cysteine peroxiredoxin (type V)    [Orthogroup: PrxV001]
Taxonomy Eukaryota Metazoa Chordata Mammalia Cebidae Callithrix
Organism Callithrix jacchus (Common marmoset)    [TaxId: 9483 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CjaPrxV
start..stop
S start..stop
MmulPrxV 380 2.18e-136 1..222 1..215
MfaPrxV 380 2.18e-136 1..222 1..215
PtroPrxV 378 1.01e-135 1..222 1..214
HsPrxV 377 3.26e-135 1..222 1..214
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7631' 'join(1..195,1540..1674,2143..2274,2346..2384,2495..2556,2800..2905)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..195 193 N° 2 1540..1674 133 N° 3 2143..2274 130 N° 4 2346..2384 37
N° 5 2495..2556 60 N° 6 2800..2905 104  
join(1..195,1540..1674,2143..2274,2346..2384,2495..2556,2800..2905)


exon

Literature and cross-references CjaPrxV
DNA ref. GenBank:   ACFV01109291.1 (5621..2720)
Protein sequence: CjaPrxV
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   222 (335)
PWM (Da):   %s   22764.03 (34687.3) Transmb domain:   %s   i12-34o
PI (pH):   %s   10.08 (4.66) Peptide Signal:   %s   cut: 23 range:23-357
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGLATLCVLRRPAGFVLFGGAAGQFVATGAAAAARAAARRRGEGG
WASGGVRSFSRVAAAMAPIK
VGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRR
LK
RFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 11, 5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGACTAGCCACACTGTGCGTCCTGAGACGCCCAGCGGGTTTTGTACTCTTTGGTGGGGCCGCCGGTCAGTTTGTGGCAACGGGAGCGGCAGCCGCAGCGAGAGCGGCAGCAAGACGG
CGAGGTGAAGGAGGGTGGGCGTCTGGCGGGGTCCGCAGTTTCAGCAGAGTCGCTGCAGCCATGGCCCCGATCAAG
AGGTGACCGCTGGCCCAGCCGGGCCTGACATCCCCCACTCTCCCC
GTGCCAACCCCTGTCCCGCTGGTCTGGGGGTGTCACCTTTCCTGCCTGCCGGACCCCTCCCGCCGCCTGCCCCTCTCATCCCCACAGAAGGCCCGCGTGGCTGCCCACCCTTCTCTCCAA
TGGTGGGGGGCCTCACCTTCTGGGACAGTCCCGAGGCATTTTTTTTTTTTTTTTTTCTGAGACAGAGTCTCATTCGCCCAGGCTGGAGTGCAGTGTCGCGATCTCGGCTTACTTCAACCT
CCACCTCCTGGGTTCAATCGATTCTCCAGCCTCAGCCTCCTGAGTAGCTGGGACTACAGGCGCAAGCCACCGTGCCCGGCGAATTTTTGTATTTCTAGTAAAGACGGGATTTCACCATGT
TGGCCAGGCTGGTCTTGAACTCCCGACCTCAGGTGATCCGCCCACCTCAGCCTCCCAAAGTGCTGGGATTACAGGAGTGAGCCACAGCGCCCGGCCTGATTTTCCCCATCTGTCTTCTGA
AACAGCTGTCCCTCAGCGACGTCGCAGGGGCTTCCCCTATCCCACTCGGTGGCCTTCCCTCCTCCTATGGCAAATTCCCACCCTCTGCCTCCTCTTTCCCTCATCTCCTGGAACCGTCCC
CAGGGCCTTGGACCTTCCCCCTGTTCCTCCCAAACCCTGGTGAGACCCCCTTCCGTTTGCTTCATCCTGCTCCCAACGCCGGGCTCCTCAGAGACTCCGGCACCTCTGACTCTCTTCCTA
CCCACTCTGGCCCCAGGAAGCCCTCAAATACTCCGGGGAGACGGATCCTTCCTCCTTCAAGAGATTCCTTCTTTTGTTCTACACGTCCTGGGTGTAGGGGCCTGGACACCCTCCCGGAAC
TTTCCCACCTGCTGCTACCCTCCCTCTTCCTCCTCGTGAGGGTGGGACCCTCAGACCTGGCCAAGATCCTCTCCCTCCATGTTTTCTGGGACTCCTCCTCACCCCCAAATGCAGCCCTCT
ACCCACCACCCCGCCCATTTATCCCACTCCTTTCCTGTAACCTAGACAGTGTTATGCAACCCTTTTGACACTTGGGGAGGCCTTCCTGCCCTTTCTCTGTTGTCACCACTGGGCCCTTAA
GAGGAGCAGGGGCAGCTTGAAACCTGGAGGATATGGGGTAACTTGGTGCGGGCGGGCGGGCAGGGAGGGCCCCTGGAAACTGACAGGTCTGGAGTTTCCTGCTAGCCGTCAGTTTCCTGC
TAGCTCCTGCAGGCGCAGCTGCCAGGCTCTCCGTTCTCACCTTCCCGCCTCCGGTTTGCCCTGATCTCTCACTGCCCTTACCTTGGAGTCCTTCCTTCTAGGTGGGAGATGCCATCCCAG
CAGTGGAGGTGTTTGAAGGGGAGCCAGGAAACAAGGTGAACCTGGCAGAGTTGTTTAAGGGCAAGAAGGGTGTGCTGTTCGGAGTTCCCGGGGCCTTCACCCCTGGCTGTTCCAAG
AGGT
GAGGCCCTTCCCTTCTGAGGACCAGGACCTGGGATGTTTTGTGTTGCTCTGAAGTCCTCCACATAGTCCTAACAGGAAGGCAAAAAGCATTTCAGTGCTACTGGAAAACAGGTAGAGGCT
GTGAGAAGGGAGCAGCACCAGGAATGCTGGCGAAAAGCTTTCTGCAATGAAATCCAGCACCCCTGTTGGTCTTGCTAAATGACAGGCACTGTGGAAGGTGCTTGGGACTCAGATAAATAA
GACATAGTTTTGCCCATGGGAAGTTCATATTCTGGACCAGAAGGCATTAAGTTTCATTCTGAGCTTCCTAGTGGCCAAGGCAAAAAGGAAATAGAATGGTTTAGACAGCCCTCATTGTTT
GATCAAAGCTGTTGAGGCAGAGCAGTGAGGAGGGCCTGGAGATGAAGGGTGGGTTGGGGGGCAGATATAGTTATCCCTTTGCTGACCCTTTATTTCCCTTCCCTAGACCCACCTGCCAGG
GTTTGTAGAGCAGGCCGAGGCTCTGAAGGCCAAGGGAGTCCAGGTGGTGGCGTGCCTGAGTGTGAATGATGCCTTTGTGACTGGCGAGTGGGGCCGAGCCCACAAGGCGGAAGGCAAG
AG
GTGAGCTGCGGGACTGCAGGGAGTCAGGGCCAGGTAGGAGATTCTTCTTGTGATGTTTCCTTTCTCTGCAGGTTCGGCTCCTGGCTGACCCCACTGGGGCCTTTGGGAAGAGGTGAGTGT
TCTGTGTTCCCCCAGCCTCGACAGGGATATAGCAGTGTGGGGAGCAGTGGGGGCCCTTGGCCTCCTCAGGGGTTTCTGACACTTTTCTTTGTCTCCTCTTAGGAGACAGACTTATTACTA
GATGATTCGTTGGTGTCCATCTTTGGGAATCGACGTCTCAAGAG
AGGTGAAAGTGGGAGAGTCCTTTGTGGGGGGAGAGTTCTCTGTGGGGGGAGAGTCCTCTATTGGGGGGAGTCCTCT
GGTGGGGGGGAGAGTCCTCTGTTGGGGGGAGTCCTCTATGGGGGAGAGTCCTTTGTGGGGAGGAGTCCTCTGTGGGGTTCTCTTGGGCCCCTGGCTCTTCACTGCCCGTCTCCATGCTCT
GCCTCCAAGCCCAGGCTGATGCAGCTGTCTGGGCCTGTCTTTCTGGCAGATTCTCCATGGTGGTACAGGATGGCATAGTGAAGGCCCTGAATGTGGAACCGGATGGCACAGGCCTCACCT
GCAGCCTAGCACCCAACATCATCTCGCAGCTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGACTAGCCACACTGTGCGTCCTGAGACGCCCAGCGGGTTTTGTACTCTTTGGTGGGGCCGCCGGTCAGTTTGTGGCAACGGGAGCGGCAGCCGCAGCGAGAGCGGCAGCAAGACGG
CGAGGTGAAGGAGGGTGGGCGTCTGGCGGGGTCCGCAGTTTCAGCAGAGTCGCTGCAGCCATGGCCCCGATCAAG
GTGGGAGATGCCATCCCAGCAGTGGAGGTGTTTGAAGGGGAGCCA
GGAAACAAGGTGAACCTGGCAGAGTTGTTTAAGGGCAAGAAGGGTGTGCTGTTCGGAGTTCCCGGGGCCTTCACCCCTGGCTGTTCCAAG
ACCCACCTGCCAGGGTTTGTAGAGCAGGCC
GAGGCTCTGAAGGCCAAGGGAGTCCAGGTGGTGGCGTGCCTGAGTGTGAATGATGCCTTTGTGACTGGCGAGTGGGGCCGAGCCCACAAGGCGGAAGGCAAG
GTTCGGCTCCTGGCTGAC
CCCACTGGGGCCTTTGGGAAG
GAGACAGACTTATTACTAGATGATTCGTTGGTGTCCATCTTTGGGAATCGACGTCTCAAGAGATTCTCCATGGTGGTACAGGATGGCATAGTGAAGGCC
CTGAATGTGGAACCGGATGGCACAGGCCTCACCTGCAGCCTAGCACCCAACATCATCTCGCAGCTCTGA

Retrieve as FASTA