1. Browse the Database
  2. View Redoxidase
Entry information : Cja2CysPrx02
Entry ID 7632
Creation 2010-10-18 (Myriam Duval)
Last sequence changes 2010-10-18 (Myriam Duval)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2011-07-25 (Nizar Fawal)
Peroxidase information: Cja2CysPrx02
Name Cja2CysPrx02
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Metazoa Chordata Mammalia Cebidae Callithrix
Organism Callithrix jacchus (Common marmoset)    [TaxId: 9483 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Cja2CysPrx02
start..stop		 S start..stop
Ptro2CysPrx02-1 405 6.91e-147 1..198 1..198
Mmul2CysPrx02 405 6.91e-147 1..198 1..198
Mfa2CysPrx02 405 6.91e-147 1..198 1..198
Hs2CysPrx02 405 6.91e-147 1..198 1..198
Gene structure Fichier Exons►


exon

Literature and cross-references Cja2CysPrx02
Protein sequence: Cja2CysPrx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   198 (1617)
PWM (Da):   %s   21731.14 (181403.9) Transmb domain:   %s   o10-32i
PI (pH):   %s   5.33 (8.02) Peptide Signal:   %s   cut: 26 range:26-1642
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASGNAHIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFVIDGKGVLRQITVNDLPVGRSVDE
ALRLVQAFQYTDEHGVCPAGWKPGSDTIKPNVDDSKEYFSKH

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 22, 4 introns)
EST?
DNA ►
Send to BLAST
CDS►
Send to BLAST