1. Browse the Database
  2. View Redoxidase
Entry information : RcPrx01 (Peroxidase 43 precursor / putative)
Entry ID 7661
Creation 2010-10-26 (Cyril Jourda)
Last sequence changes 2010-12-28 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: RcPrx01 (Peroxidase 43 precursor / putative)
Name (synonym) RcPrx01 (Peroxidase 43 precursor / putative)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx01
start..stop		 S start..stop
MePrx74 473 1.86e-169 1..326 1..329
GaPrx08 436 3.12e-155 6..326 12..327
GhPrx35 436 7.01e-155 6..326 12..327
CclPrx24 431 4.31e-153 1..326 1..329
Gene structure Fichier Exons►


exon

Literature and cross-references RcPrx01 (Peroxidase 43 precursor / putative)
Protein ref. GenPept:   XP_002526174.1
DNA ref. Phytozome 12:   27985 (339939..341447)
mRNA ref. GenBank:   XM_002526128.1
Protein sequence: RcPrx01 (Peroxidase 43 precursor / putative)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (305)
PWM (Da):   %s   35310.14 (32888.8)  
PI (pH):   %s   8.15 (7.99) Peptide Signal:   %s   cut: 22 range:22-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLNYNLKTLVFSLLIIHTCFGVSKGNLRTGFYSQTCPLAEAIVLN
VVKTAVSVDRQVAARLLRLFFHDCFVQGCDGSILLENGETGERSARGNLGVGGFEVIQDAKTHLEGICPGMVSCADIVALAARDAVFLTNGPFFGVPTGRRDGRISKISFAANLPEVDDSIEILKSKFQAKGLSDEDLVLLSGGHTI
GTTACFFMPRRLYNFSGRGDSDPKINPKFLPQLKTQCPLNGDVNVRLPLDWSSDSIFDDHILQNIRQGFAVIASDARLYDDRNTKQIIDSYVGSTGKGRRSFGADFAKAMVKLGNVDVKT
GSQGEIRRVCNAVN

Retrieve as FASTA  
Remarks Complete sequence from cDNA. No prediction from phytozome. No EST.
DNA ►
Send to BLAST
CDS►
Send to BLAST