Entry information : PpalPxDo01 (PpalPoxA)
Entry ID 7698
Creation 2010-11-17 (Marcel Zamocky)
Last sequence changes 2010-11-17 (Marcel Zamocky)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-11-18 (Christophe Dunand)
Peroxidase information: PpalPxDo01 (PpalPoxA)
Name (synonym) PpalPxDo01 (PpalPoxA)
Class Short peroxidockerin    [Orthogroup: PxDo001]
Taxonomy Eukaryota Polysphondylium
Organism Polysphondylium pallidum (Cellular slime mold)    [TaxId: 13642 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpalPxDo01
start..stop
S start..stop
DdPxDo01 615 0 12..534 9..530
PlmaPxDo01 353 2.72e-113 20..537 92..590
BmaPxDo01 349 3.96e-113 24..533 22..510
LspPxDo01 339 1.84e-109 24..535 144..661
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7698' 'join(1340455..1340748,1340811..1341086,1341164..1342213) ' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1340455..1340748 292 N° 2 1340811..1341086 274 N° 3 1341164..1342213 1048  
join(1340455..1340748,1340811..1341086,1341164..1342213)


exon

Literature and cross-references PpalPxDo01 (PpalPoxA)
Literature Gloeckner G., Schaap P., Noegel A.A., Felder M., Eichinger L., Heidel A.J., Platzer M. Living fossils from the dawn of multicellularity. (unpublished since 2009)

Protein ref. GenBank:   EFA85041.1 UniProtKB:   D3B167
DNA ref. GenBank:   ADBJ01000008.1 (1340455..1342213)
Protein sequence: PpalPxDo01 (PpalPoxA)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   539 (516)
PWM (Da):   %s   61147.18 (58655.8)  
PI (pH):   %s   6.6 (6.26) Peptide Signal:   %s   cut: 24 range:24-539
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARNISLKLLVFVLFSLTIACSAEWRSYNGYGNNLKDPTLGMANT
TFLRSVKPSRYNAFGYLNLSIPSARYVSNNVMDQPFEIASHEGLTDLFNMFGQ
FLIHNMAFAQPDTNTPWPITVPECDEYFDPWCSGNQTMSYFRTRVALVDCAKGNTNPQEDGRCYEQINALSSFIDANPVYGSTKETADLLRSFSGGQLRVSKDPHGDMPPRGIKGVTIDN
DARRVPIDQLFTVGEKRGNENPGLMSIHTIFLREHNRLAKKFSGLNSSMTDEEIYQKTRSCIIEQVQALTYNEYLPMILGHKMPDYKGYDENADPRISNEFTTVAFRFGHSEVGPVIEMG
NRDGSFGTPLPIRDSYFNPNALSDGIEPIIRGLAFKVEQNVDPYMISDLRNFLFGKPGQGGFDLACRNIQRERDHAIPSYNKYRSLLGLPSVKRWSDISREPIIQSNLRYTYDNKLDNVD
LFVGGLAENHVPGGCVGQTFYTMILEQFTRSRSADRFWYERENMKEINQQCERTTFRELIRRNTNDIGPIQNNVFKVPTDL*

Retrieve as FASTA  
Remarks Complete from genomic (2 introns). Strain="PN500". No EST found.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGAAATATATCATTAAAATTACTAGTTTTTGTATTATTTTCTCTAACTATTGCTTGCTCCGCCGAATGGAGATCGTACAATGGTTATGGTAACAACCTTAAAGACCCAACCCTT
GGTATGGCAAATACCACTTTCCTCCGTTCTGTAAAACCAAGTAGATACAACGCTTTTGGATATCTCAATCTTTCCATTCCCAGTGCCAGATATGTCAGTAATAATGTAATGGATCAGCCA
TTCGAAATCGCTTCCCATGAAGGTTTAACTGATTTATTCAATATGTTTGGACAG
AGGTAAGTAAAAATTATTTAAGAAAATAAATTAAAAATATTTACTAACTAATTTACGAATTTAGTT
TTTAATTCATAATATGGCATTTGCACAACCAGATACAAACACACCTTGGCCAATTACCGTTCCAGAGTGTGATGAATATTTCGATCCATGGTGTAGTGGAAACCAAACTATGAGTTATTT
TAGAACTAGAGTTGCCCTAGTCGATTGTGCTAAAGGTAATACCAATCCACAAGAAGACGGTAGATGTTATGAACAAATCAATGCACTTTCCTCCTTTATCGATGCCAATCCAGTTTATGG
ATCAACAAAAGAAACTGCTGATTTATTAAGATCT
CTGTAAGTTAATATATAATATTTGAACATGAACAAAGAAATAATAATAATATTTACTCAAATATCTTTTTTTTTAAAAGTTTTCCG
GTGGTCAACTTAGAGTATCAAAAGACCCACATGGTGATATGCCACCAAGAGGAATCAAGGGTGTTACAATTGATAATGATGCTAGACGTGTTCCTATCGACCAGTTGTTCACTGTAGGAG
AGAAGAGAGGAAACGAGAATCCAGGTTTGATGTCCATCCATACCATCTTCTTACGTGAGCACAACCGTTTGGCAAAGAAATTCTCTGGACTCAATAGCAGTATGACCGACGAAGAGATCT
ACCAAAAGACAAGAAGCTGTATTATAGAGCAAGTTCAAGCATTGACCTACAATGAATACCTCCCAATGATCCTTGGTCACAAGATGCCGGACTACAAAGGTTACGACGAGAATGCCGATC
CACGTATCTCCAATGAGTTTACCACCGTTGCATTCAGATTCGGTCACAGTGAAGTCGGTCCAGTCATTGAGATGGGTAACCGTGACGGTAGCTTCGGTACTCCTTTGCCAATCCGTGACT
CCTACTTCAATCCAAATGCACTGTCCGACGGAATCGAGCCAATCATCCGTGGTCTCGCTTTCAAAGTAGAGCAAAATGTCGATCCCTACATGATTTCCGATCTTCGTAACTTCCTCTTTG
GTAAACCAGGTCAAGGTGGATTCGATTTGGCCTGTCGTAACATTCAGCGTGAACGTGACCACGCCATTCCATCGTACAACAAGTACCGTAGTCTTCTCGGTTTGCCATCGGTCAAGAGAT
GGTCAGACATCTCGAGAGAACCAATCATTCAGAGCAATTTGAGATACACCTACGACAACAAGCTCGATAATGTCGACCTCTTTGTTGGAGGTCTCGCCGAAAATCATGTTCCAGGTGGAT
GTGTCGGTCAAACCTTCTACACAATGATCCTCGAACAATTCACTCGTTCAAGATCTGCTGATAGATTCTGGTACGAAAGAGAAAACATGAAGGAAATCAATCAACAATGTGAAAGAACAA
CATTCAGAGAGTTGATTCGTAGAAATACTAATGATATCGGTCCAATTCAAAATAATGTATTTAAAGTTCCTACTGATTTATAA

Retrieve as FASTA