Entry information : AtPrx01 (At1g05240 / PER1 / Atp11a / Atatp11a / AtP11)
Entry ID 77
Creation 2006-07-20 (Filippo Passardi)
Last sequence changes 2012-06-05 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-11-04 (Christophe Dunand)
Peroxidase information: AtPrx01 (At1g05240 / PER1 / Atp11a / Atatp11a / AtP11)
Name (synonym) AtPrx01 (At1g05240 / PER1 / Atp11a / Atatp11a / AtP11)
Class Class III peroxidase    [Orthogroup: Prx027]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue type Roots hairs
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx01
start..stop
S start..stop
AtPrx02 665 0 1..325 1..325
AlyPrx02 515 0 1..325 1..321
AlyPrx01 515 0 1..325 1..321
CrubPrx51 506 0 1..325 1..320
Gene structure Fichier Exons


exon

Literature and cross-references AtPrx01 (At1g05240 / PER1 / Atp11a / Atatp11a / AtP11)
Literature REFERENCE 1 Kim BH, Kim SY, Nam KH. Genes encoding plant-specific class III peroxidases are responsible for increased cold tolerance of the brassinosteroid-insensitive 1 mutant. Mol Cells. 2012 Dec;34(6):539-48.
REFERENCE 2 Lan P, Li W, Lin WD, Santi S and Schmidt W Mapping gene activity of Arabidopsis root hairs Genome Biology201314:R67
Protein ref. UniProtKB:   P0DI10
DNA ref. Phytozome 12:   Chr1 (1521202..1522447)
mRNA ref. GenBank:   NM_100403.3
Cluster/Prediction ref. Phytozome Gene 12:   19657003 UniGene:   At.139
Omic ref. AtProteome:   At1g05240 ATTED-II:   At1g05240 e-FP Browser:   At1g05240 ePlant:   At1g05240 TAIR:   At1g05240
Protein sequence: AtPrx01 (At1g05240 / PER1 / Atp11a / Atatp11a / AtP11)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (304)
PWM (Da):   %s   35487.74 (33397.5) Transmb domain:   %s   i7-26o (i7-26o)
PI (pH):   %s   9.73 (9.62) Peptide Signal:   %s   cut: 22 range:22-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAIKNILALVVLLSVVGVSVAIPQLLDLDYYRSKCPKAEEIVRGV
TVQYVSRQKTLAAKLLRMHFHDCFVR
GCDGSVLLKSAKNDAERDAVPNLTLKGYEVVDAAKTALERKCPNLISCADVLALVARDAVAVIGGPWWPVPLGRRDGRISKLNDALLNLPSPFADIKTLKKNFANKGLNAKDLVVLSGGH
TIGISSCALVNSRLYNFTGKGDSDPSMNPSYVRELKRKCPPTDFRTSLNMDPGSALTFDTHYFKVVAQKKGLFTSDSTLLDDIETKNYVQTQAILPPVFSSFNKDFSDSMVKLGFVQILT
GKNGEIRKRCAFPN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 3 introns). Identical to AtPrx02. Shorter, irregular, but more frequent root hairs in the mutant line Salk_10357C. Transcript and protein are referentially detected in root hairs.
Promoter
Send to BLAST
Send to cis Analysis
Terminator +
Send to BLAST
Send to cis Analysis
DNA
Send to BLAST
CDS
Send to BLAST
cDNA
Send to BLAST