Entry information : KflPrx01 ( kfl00004_0140)
Entry ID 7730
Creation 2010-11-04 (Qiang Li)
Last sequence changes 2014-08-20 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-07 (Christophe Dunand)
Peroxidase information: KflPrx01 ( kfl00004_0140)
Name (synonym) KflPrx01 ( kfl00004_0140)
Class Class III peroxidase    [Orthogroup: Prx328]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflPrx01
start..stop
S start..stop
KflPrx02 262 2.11e-86 23..263 27..269
LminPrx28 144 5.64e-41 63..331 40..327
GhPrx01 144 7.84e-41 63..314 39..308
GmPrx173 143 1.39e-40 63..324 34..316
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7730' 'join(1..69,551..653,1174..1269,1752..1822,2177..2239,2720..2839,5956..6010,6357..6435,6849..6972,7395..7474,8081..8216)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..69 67 N° 2 551..653 101 N° 3 1174..1269 94 N° 4 1752..1822 69
N° 5 2177..2239 61 N° 6 2720..2839 118 N° 7 5956..6010 53 N° 8 6357..6435 77
N° 9 6849..6972 122 N° 10 7395..7474 78 N° 11 8081..8216 134  
join(1..69,551..653,1174..1269,1752..1822,2177..2239,2720..2839,5956..6010,6357. .6435,6849..6972,7395..7474,8081..8216)


exon

Literature and cross-references KflPrx01 ( kfl00004_0140)
Literature Timme,R.E., Bachvaroff,T.R. and Delwiche,C.F. Broad phylogenomic sampling and the sister lineage of land plants. PLoS ONE 7 (1), e29696 (2012).
EST ref. GenBank:   HO437950.1 [Fragment]
Cluster/Prediction ref. klebsormidium DB:   kfl00004_0140
Protein sequence: KflPrx01 ( kfl00004_0140)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (305)
PWM (Da):   %s   35549.93 (32707.4)  
PI (pH):   %s   4.89 (4.64) Peptide Signal:   %s   cut: 27 range:27-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPWTGARFLWLASLLAALTFPQTKAFDLTTGQLFNFAPLPTGSLPNEPLspan>FTPDLRACVFANIQRSLSNLTLSDSQTNARFLRLIFHDCASGGCNGSIMKLQEQKAFVNTFLGYDKVQIVKAAADAACGSNLSYADTIVAGAFIGVYLSGGPNV
TQYVRLGRADTDGLDDPER
LPSAFTLNDDLIKTFAVLGLNVEELVALSGAHTLGKATCANVTPRIGGDPYADPQFLYGLTNQCRTLLQQLSMDLSPTQFDTSYYVMQTGKGILQTDEGLY
AENTTRAYTQ
LFASNQTEFFSSFAVGLLKMSLIGLRPPSVSNVSAGLDRTSEFGA

Retrieve as FASTA  
Remarks Complete sequence from 1 EST and genomic (10 introns). Incorrect prediction from Klebsormidium DB (extra last short exon)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCCTTGGACCGGAGCTAGATTTTTATGGCTGGCCTCCTTATTGGCAGCACTGACATTCCCACAGAGGTAAGGGGAGTTGCTTATCAACAGGACGAGTTTTCGATTTTTTGCGCCG
AGTACAAGTTGTTTCCGCTGCTTCACATGGATATTCGTTGAAACTGTGCAAGATGGGCATAGTGGGGGACTTTACTTACGGGTGTGAAATGATAGGCAATCGCCATGCACTTTTCTGGTG
CATGCGGTCCTGTTTGCCTGGCAACTGATCAATCGAGAATCTGGGGAGTCCCCTCCTGAAGACTTAGCTGAGGTGGTCATTGCGATTGTTCGTGAAGCTGCAGTGTTTGGAAACTTGAAC
GGCTTGTGCATCTTATCTAGGTCGTGCAAGAGCATCACGTTATCATATTACAGTGAGTGGGGAAAGGATAGAAGGTACATTTGATAAATGAGGAATCCCCTTCCGACTTCTTGGAAACGG
AATATGGCTATCCAAAGCACCACGCGTGGATCCAACAGAGCCCCAAAAGTTTGCCTTTACTTCCTTGTGCAGACCAAAGCGTTTGACCTGACAACCGGACAATTGTTTAATTTTGCCCCT
CTCCCAACGGGGAGCCTTCCAAACGAGCCCCTCTTCACCCCAGATCTACGAGCAT
ATGTGAGTCGGCTTGTTTCCCATCATTCGGCTTTAAAGTTTGGATAGTTCTGCCCTGGAGGCGCA
CGAGTACGATTCATATCTGCTCAAAAGCTTGCCAAGAGACAGAAAGTGAAGCACTGGTAGTCCCCCATGCCACTTCCCTTGCTTTCATGGGTTGGAACTCGATGAATCTGTGGGTTTTGA
CGCCGAGGTTATCTGTGAGGCAAGAGATTTTCTTACTACCGCAGGAGATTGTCGTCTTTGCCGAGGTCAGTTGTACATCCAGAAAGTTTGCCAACATCTTTTCAGTCGCACCATGTACGT
TCCATTTGATCTTAAGCATTGCTGCGCCTTCTCAGGAAACGAATATCCCAAGGTCTCTCTCCAGCGGCGCACATCCTTTGTGATGTGACTGATTTTTCTGCAAAATTGGTGATCACGTGC
TTTTCAGAGCGACCGCTAGAGCGAAGCTTCGGCGAAAGGCAGGTTCACTCAGTAGGTCTTCCGTGCCATCTTAACCTCTTTTCACCCGTTTTTGCAGGTGTTTTTGCAAACATCCAAAGG
AGCCTATCCAACCTGACACTGTCAGACTCCCAAACCAACGCAAGGTTCTTGAGATTGATCTTCCATGACTGCG
CGGTAGGTTCCGAGCTCTGGTTCCAAAATCACCCCATTGCACTAAAC
TCCCTGTACAGCCTTCCGTTTGCTGACCAGTAATACTCTCGGGGCTGCTTCTGGTCGGGTCCTGTGAGCGAGTGCAGGGGCATGCACGGCCTCCAAAATCACACATCTTGGTCGCTTCAA
TTGCTTATCGCAATTCATCTAGCAAAGGATCTACAACTCGTGTGAGTCGAAGTGCATACGTGGCCTCAGGTTGATTTGGTAGATATGCTGCTTGATCTTCTGCCTGGTCCTTGCTTCTCA
GTAAAGTCCCAGCGACTCGAGAGCACTTGTTGGCTTGAACAATCGTAGCAATCGTGAATCGTCACTCAGTGGCACCTGCTTGAGCCCTATGTTGCGAAGAGCCAGGATCTGGGAAGGCTT
TGTAGAGTGTAAATATTGCTGACACCCCCTGACAATGATGCGACTTCGAAATGGCACGTGTCATCATCTCTTTGCAGCATCGGGCGGGTGCAACGGGTCGATCATGAAGCTACAAGAACA
GAAGGCCTTTGTCAACACTTTCCTGTCG
CGGTAAGTGTGCCCACTGACCGGAATACATGGTTGATTTGGTCTTCAGCTGCACGATTCAAGCGCAGGCCTGTGTCTTATGCCAGCGGTCGG
GTTCCGTTTAATTTCCCGCTAGTAAGTTTGGGATAGGCATATGGATTCGTCACTGGTGTGGAAGTCCTTCTCTGGAAATCTCTGCTCTTGTAAGTTGACAGGCGATCTTGTCAGCCGTTC
AATGCGTGACCTAGTATGCGCAGTGACTTCTGCTTTGTACGCTCGCCGCTTGTCTCTCCCAAGGCTTTCGTTGTGACTGCTCTATTCCAAACGCCGCGAAAATCAGGCCTCAGGCTGACC
ACATTTCAAGTGGCTCTTTTTCAGGGTTACGACAAGGTCCAGATCGTCAAAGCTGCAGCGGACGCCGCCTGTGGCTCCAACCTGTCTCTGTAAGTCTCTTCTCCAACGTCCGATATTAAA
ACTGTCCGTGGAACGAATCTGAAGAAGCCGGTTGAGCGATATTGCGAGGTGATGGTATTGTGAGATGATAGTAGAAGGAGTCAGGTATTTTGTTGCTGATTCCTGGCAGGGTTGGAGTGC
GTTTTGCGTGCCTGCGGTTCAGCGTGATTCATCTTGGCGAGTTTCCGCTACGTTGTTGGTCGGGCACAAGTTCGCTCAGGCAAGGAGGTTGATCCTGCGCAATTGCCGTATGACAGACAC
CAACGAATCCTTCATTTCAGGTCTCTCACCATTTCATGGGGACACCTTCTCAAAAGTCGGTCATCTGGTTCTTGACCAGGACTTTTTCCGGATGTCTCTAAACGAGGAGCAAATGAGATT
CATACGCACCGGAGACTCCTGTCTTGAGTGTTTTTGAAATCGTTTTCAGAGTACACACTCACTCTTGTGTCTCCTTTTCTTTCGGACAGTATGCGGACACAATCGTTGCTGGGGCGTTCA
TTGGGGTGTACTTGTCCGGTGGTCCGAACGTCACGCAGTACGTCAGGCTGGGGAGAGCTGACACCGACGGGTTGGACGACCCGGAGAGG
GGGTGAGCGCTCCGATGAAAACGTCTGATTG
TTCAGTCCTGTTTCTCGCTAGCGGCCTTTGATCATTTGATGTGGATTGTTATCCACGTACTTGTATCCAACGCTGATTGGAGAGCTAAGCCCCATGCCTTTGATGGACACGGGCTGTGGA
TGAGGATTTCCCAGCTAGGCTTCGTGTAGATTCCGTCCTTTGATGCGGCCGCTGTGCAATGGCGTCGCAAGGCATTTGACTTGTCGCCTCATTCTCTTTAAGCTTAGCTGGAGCCGTGGT
CGCTCTTTGCTTGCTAGCTCAGGGTTCCCCTTTATTTCTGTATCTCCTTCTGCTTCCGATTATCTTTCCTTCTTTGTCGTCTTCTGCTTCGCGAGCCGTTACACTTCATTGCCTCTTTTC
AAGTTTTCTGTTGGGCAACGTCCCTTTCTTGCATAAAACAGCAAGGATCCGGCTTTTATGTCTACCTGAGGGTATGCCCGCTTGAGCGTGACGAAAGCATTTTCTGCTCCCCCGTGTTGG
AACTCTAAAAAATTGCGATCTATCAATCGACGGGAAGCACTGTAACGCGAGTTCGTCAATTTTTGCATTTGCCAGCCAGCTGTCAAAGTTTTTATCAACGGGTGCTGTCGGATTATGAAG
TCCGTTCAACTCAGTCGTCTGGTTGCGGCAGAGACAATGCTATCATCGATATAGAGACTTTCTCATTATTTGCGGTGCTTGTACGTCATGCTGGACCGCCAAGATGGTCGGGTGCTTATT
TTGGCTAATGGTTTAGAGTACGTCCCACGCTCCGTGCCTTGTTTTGTTGCTGAACCGCCTGCGTCTAGGTCGACTCTCAGCGGTTATGAGCACTACTGGTTATGACGACTTCCTGCACAA
TCTTGGCGCCTGAGCTTGGCCTCTTTCCCCCGAAGGCTATTTGGATTTGGCACCACCTTTTGAGCTTCTGCTTCCTTATACTACTAGTTGAACGAGGAAGGGTGGAGGTACGTTGCTTTA
CAAACAGGCCACGAGATTTATAATGGATTGTAATCGAGGAGTGGAAGTTCAAGCTAGAGCAGCGGTTGGCGTCTGCAATGTTGAGTTGTGCGTTTGTTTTCAACAACATCAACTATGGGA
GCTTACATCTAATGTCGAGATACTATGCAGATGTGGCACGGGCACTGAGGATCTAAAGCGCCGAGCTCTCCTGCGAAGGGAGTTTACGGCTTGTTTTTCTGAGCCGCTTTTTTGTAACGC
TTAATTCCTTGACGTCCTTAAAAGGCGAAGGTGTCGAACAAGCGAGTCCCAGCGTAATGGTTCGGGGACCTTTTGTTCTCATCCAAAGCCCGAGTCACGCTGGTCGTCGATCTGAAATGT
TCCACTGAAAATCTTGAGGCCTTCGAACGATTTCCCATTCGATTCTTTGCCCAGGAAAAGCTGCCAATAGTAAGTGGTAATGAACGTCGGTTCTTATCGGACATCAACGGCGTGTTATTC
CAGATGGCACTGTAGCAGCAGCGACGTAGGCTAAGGCTAGGAGGATTGAGTGTGTGGGCTGATTCAGTTCCATACATCCTTCTAATGATCCTGAGCCAGCGTGCATACAGAATGTTGCAG
TCTCCTTATCTCTCGTATCTTTGCAACCCACTTCGCAACCTGAGCGTCGAATACTGCCGACTCAACGGTATTGGACCGATGGTGCACGGGCTATGAGCATCTAGCAAGTTGTCTCGCTTG
TTGAGACACAGTTTTTGATCTACGCAAGCCTGATACTAAGATACTGACTCAGTTGGATTGGGGCTCACAATCACCCACTGTTGGCTTTATTCAGAGCGTGATATACGGAAACAAGGAGGT
GCATAGGAAAAGACACGTTGCAGCGTTAGGCTGGCTTGAAGTGTCGCTTCAAGGGAGCTTCTTGGCGGACCTTTTTTCGCTTCTGATAGCGTGCTCGACGCGTTTCTCTTCTGAGCAACT
CTTCCTTCCATAGGTCGTTTTGTGCGGTTGATTGGTATTTCAAGGCACTCATTCCCTCATCAGGGTGTCGCTTTTGATATGGTGAATGTTCCTGGCTGCACAAGTCCATTTTGACAGTAC
TGGGGGTTGGTACGTTCAAGCACTTGGGTCAGGGGGCTCGTACGCTCTGGTTTGCATTCTGGAACAGCCTTGTGTTGAACTTTGTCTCGATGCAAGTCTTTTCTCAGCGATGTTTTGATT
TCAACGGCAGTTTGTCTCGAGCCATGCCTGTCTTGAGGTCTCGTGTGCTCCCTTCAGACTTCAATCATGCAATTCGTTGTTGTGAGTTGAGCATCTGAAAATCGCTTTGTTTGAAGATTT
TCAGTATGTGGTCATGGAATTTGCCTCGGTCTACTTCCTCATCTGTGCCCTCATTTGCTGGGCCAGTGACGCAGGGATTGGATTTTCGGAACGTTCAAACGGCTCAGGGTGGCACTTCCG
CTCCCTACAAGAGCATTCTCCACCCTATTCCGTTCCTCAAATGGGAAGCTTGCTTATCGTCGCTATTGCAGTTTCTGCTGATCATCCGAGTCAACGAGGCGCTTTCTCACGATGCCAGCT
TCTTTGTAAAGAGGATTGCTCCTGTACTTTAAGCTACTGTAGGTGGATTCGGGTCCTTACTTTCAACAGTGGCAGAGACTTCCATGTGCATTCGATATTGGAATACTCAAAAGCTGTGAA
GCAAATAGTCCCGTTTGAACGCCACTCCTGGTCGTCACAGCCAGCAAGAAGGCAATGAAGCTGTCAACGTTGACATCTGTTGTTGGGGCACCATCGAGCCACGTACCGACGTAGTTTTTT
TCGATTTTGAGAAACCAGACTTCTTTTACTGTTTCCTGTGATGTGTCCTTGGTCCAGCTTGCGGATTTTTGACATTTTCTTTGCCGGTCTCCAAACATCGATGTCCTCCCAGGGATGTTT
CAACGTTGGGGTTCGATCCTTTATGATGTTATTCATGGCGTGTAAGGACCGGCGACTATTCTAAGATGATACGCAAGATGGTAAGCACATCAATGGAACGCACAGTGTCAATATTCTGTT
CTGCAGAGGGTTGTGCTGCGGCACACACAGTCCTCTTGCAATGCTTTGATGCAGAACATCTGGTTGACAAATTCTCCCTGCTTACAGCTGCCGTCGGCGTTTACCTTGAACGACGACCTG
ATCAAGACCTTTGCCGTGCTCG
CGGTAAGCTGTGCGGATATCTTAGGATGTCTCTTGATGCCGGTTTGACTCGAGAATTCGCAGTCCTTCGAGACATTCGTACAACGCTTGACCTTCTGA
AACCACGATCTTGGGGGCCGCGATTGCTAGCTTGATTTTGAGCCTCCCTTGAACCCTCCAGAAAGTCACTCAAAAAACGCCGCAGGATTTGCACTTATGACAGGTAATCTTGAGCTTCTT
CCTCAATTGAGGACTGACAGCATGCAAAAGGCTTGTTTGGTAAAAGTCGGCTATGCTTCGATGCTCTGAGCACGGCAGACTTGGCCCTTGTGGTGCCCTTTTTCAAACGCGTTTTTCGGC
GTTTCTGCAGGTTTGAATGTGGAGGAGTTGGTCGCCCTCTCCGGGGCCCACACGCTCGGGAAGGCGACGTGCGCCAATGTCACGCCAAGAGGTGAGGCGGTTCATGACACGTTGCTGGAC
GATCTAGGGGGCCCAACGAATCGAGGTGTCACAAAAAGAACACGTTTTCTTTTGAATCGCAGTTGTTTTCCTTTTCGAATGACTGGCATAGCCTTTCAGGACCGAGGGCGGCCGTTTCTG
CTTGCGAAATAGTTTTGTTAAGCCGCCCCACTCATCGTTCGACGGGACGCTCATACTTTTTTCTCCCGCAGACTCGTAGCATCATTTCGCGCTTCACAAGTTGCTTATCAAGTCGCCTTT
TTGGTAATCAAACCGAAAGCACTTACATTCAACTTCAGATCGCCCCTTTCAGCGTTTTTCTTGATCACGCAGTGGTTATCCAGACGTCTCTTTGCGCGGAATCCCGTGAGAGCATTTGTT
TAGCAGATTTTCTGGTCTGTGCAGGATCGGCGGGGACCCATATGCGGACCCACAGTTTCTGTACGGCCTGACCAACCAGTGCCGGACGTTGCTGCAACAGCTGTCCATGGACCTGTCGCC
GACCCAGTTCGACACCAGCTACTACAAG
AGGTAAGCTATGTTTAAGAAAGTCTTTGTTGTTGTTTACCTGCTCTTGGAGCTAAGCGTGACAGAAGGGGCGCCGGATTTGAAGTTGTATTT
GCCTTCCATTTGACATCGTAATGAAGCCTGATGTTTGCAAAGCTTCTGCGTCGGCGAATAGTGTGTACTAAAAGCTGACCAAGTAGAGATGAGTCAGTGTACGGACGTGTACGTCGCCTT
GAGCAGCGGTGGTGCAGGGGTTCTGGATTTCAGCAAGCTACGTGCTGCTTGGAATGGGCGAACTTACGAGACCTTATCAGAGATTGAATCTTTAGACAGAGCCCATTCTTTCGTCCGGTC
AAGCATCAAAAGCTCTCTGAAGGCCGGTAGACTATTCTGACCGACCAATCGTCTCTTCGGTTGACGAGGCCTCTGCTCTTGCTCACTTTCAGGTGATGCAAACCGGGAAAGGCATCCTGC
AGACCGACGAGGGCCTCTACGCCGAAAATACAACCAGGGCATACACCCAATT
TTGTAAGTATCCGGCGCGAGCTGTCGTTCAGAAGCTTCCTACATCTCCTTTCCATTGTCGATGTATTC
TGATTTCGGCAGCGGGGATTTGCGGAAGATTGTTTTGCGCCAGTCCAATCCTTTCACCCGCTCACTTGGATTGTGGAGCCGTTCCGTGGCATATTATCGCCGAGTTGTAATGGCCAGAGT
ACCGAAAGGGCCACAGAATCGGTTCAATCAAGCAGATACAGCAAGCTTTTCTAATCCGCTAAATGGCAAGCCGCTCAAAGAGGTTCTTCAGCGAGTTCCACGTCCCAAGCGAGCAGTACT
GCGTCCGCCTCCCTTGTCACTTCTGTTGTCAAACCGACGAAATGGGTGCCGCGTTTGAGTTTCCACCGAAGCCTGACTGTCGCGCTCGAACAGTGAATGAGTACCCTTTGCCCTCTCAAT
CTTTCGGAGACTAGCGCTTTTCACTGCGCTGGAAAGAAAGGTCTTTTCTTGTGTTGATCTGTAACCTAGCACTAGCCACACCGAGTTTCAGATTTCTTTGTACGGTTCATGTTGATCTGA
CCGAAGCTGACACTCGAAAATTGCAGGCCTGACGCTGAGCAAGTGCTGGTTATGCTGCAGGTTTGCCAGCAACCAGACCGAGTTTTTTAGCTCCTTTGCGGTAGGGCTCCTCAAAATGAG
CCTTATCGGTTTGCGGCCGCCCAGCGTATCCAACGTCTCGGCGGGGCTGGATCGAACAAGTGAGTTCGGTGCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCCTTGGACCGGAGCTAGATTTTTATGGCTGGCCTCCTTATTGGCAGCACTGACATTCCCACAGACCAAAGCGTTTGACCTGACAACCGGACAATTGTTTAATTTTGCCCCTCTC
CCAACGGGGAGCCTTCCAAACGAGCCCCTCTTCACCCCAGATCTACGAGCAT
GTGTTTTTGCAAACATCCAAAGGAGCCTATCCAACCTGACACTGTCAGACTCCCAAACCAACGCAAGG
TTCTTGAGATTGATCTTCCATGACTGCG
CATCGGGCGGGTGCAACGGGTCGATCATGAAGCTACAAGAACAGAAGGCCTTTGTCAACACTTTCCTGTCGGGTTACGACAAGGTCCAGATC
GTCAAAGCTGCAGCGGACGCCGCCTGTGGCTCCAACCTGTCT
TATGCGGACACAATCGTTGCTGGGGCGTTCATTGGGGTGTACTTGTCCGGTGGTCCGAACGTCACGCAGTACGTCAGG
CTGGGGAGAGCTGACACCGACGGGTTGGACGACCCGGAGAGG
CTGCCGTCGGCGTTTACCTTGAACGACGACCTGATCAAGACCTTTGCCGTGCTCGGTTTGAATGTGGAGGAGTTGGTC
GCCCTCTCCGGGGCCCACACGCTCGGGAAGGCGACGTGCGCCAATGTCACGCCAAG
GATCGGCGGGGACCCATATGCGGACCCACAGTTTCTGTACGGCCTGACCAACCAGTGCCGGACG
TTGCTGCAACAGCTGTCCATGGACCTGTCGCCGACCCAGTTCGACACCAGCTACTACAAG
GTGATGCAAACCGGGAAAGGCATCCTGCAGACCGACGAGGGCCTCTACGCCGAAAATACA
ACCAGGGCATACACCCAATT
GTTTGCCAGCAACCAGACCGAGTTTTTTAGCTCCTTTGCGGTAGGGCTCCTCAAAATGAGCCTTATCGGTTTGCGGCCGCCCAGCGTATCCAACGTCTCG
GCGGGGCTGGATCGAACAAGTGAGTTCGGTGCTTAG

Retrieve as FASTA