Entry information : ZmPrx70 (pmPOX2b / PRX70 / Peroxidase 70)
Entry ID 780
Creation 2009-04-16 (Christophe Dunand)
Last sequence changes 2009-04-16 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-09-04 (Qiang Li)
Peroxidase information: ZmPrx70 (pmPOX2b / PRX70 / Peroxidase 70)
Name (synonym) ZmPrx70 (pmPOX2b / PRX70 / Peroxidase 70)
Class Class III peroxidase    [Orthogroup: Prx091]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation Plasma membrane
Tissue type Roots
Inducer Drought
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx70
start..stop
S start..stop
SbPrx45 563 0 21..321 17..318
SiPrx122 560 0 7..321 24..338
OsPrx109 477 2e-171 21..321 18..318
TaPrx114-1A 454 3e-162 23..321 21..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 172752580..172752795 216 N° 2 172753549..172753740 192 N° 3 172753849..172754406 558  
join(172752580..172752795,172753549..172753740,172753849..172754406)


exon

Literature and cross-references ZmPrx70 (pmPOX2b / PRX70 / Peroxidase 70)
Literature Mika,A. and Luthje,S. Production of active oxygen species and sequence analysis of plasma membrane-bound peroxidases from maize (Zea mays L.) roots.
Protein ref. UniProtKB:   A5H452
DNA ref. GenBank:   AC210153.3 (99674..101500)   CG186903 (99674..101497)
mRNA ref. GenBank:   EF059717
Cluster/Prediction ref. UniGene:   Zm.10660
Protein sequence: ZmPrx70 (pmPOX2b / PRX70 / Peroxidase 70)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (296)
PWM (Da):   %s   33276.92 (30894.7) Transmb domain:   %s   i5-27o
PI (pH):   %s   8.82 (8.95) Peptide Signal:   %s   cut: 26 range:26-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSFTSLSVMVLLCLAAAAVASAQLSPTFYSRSCPRALATIKAAVTAAVAQEARMGASLLRLHFHDCFVQGCDGSVLLNDTATFTGEQTANPNVGSIRGFGVVDNIKAQVEAVCPGVVSCADILAVAARDSVVALGGPSWRVLLGRRDSTTASLTLANSDLPAPSLDLANLTAAFAKKRLSRTDLVALSGAHTIGLAQCKNFRAHIYNDTNVNAAFATLRRANCPAAAGNGDGNLAPLDTATPTAFDNAYYTNLLAQRGLLHSDQQLFNGGATDGLVRTYASTPRRFSGDFAAAMIRMGNISPLTGTQGQIRRACSRVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (Chromo 7, introns 1 and 2), 1 mRNA and 10 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTCTTCTTTTACTTCCTTGTCAGTGATGGTGCTCTTGTGCCTAGCGGCGGCGGCGGTGGCCTCGGCGCAACTGTCGCCGACATTCTACTCCAGGTCGTGTCCCAGAGCTCTG
GCCACCATCAAGGCCGCCGTGACGGCCGCGGTTGCGCAGGAGGCTCGCATGGGGGCCTCCCTGCTCAGGCTCCACTTCCATGACTGCTTTGTCCAA
GCAAGTCCCTCTCAAGTCGATCTC
ATTATATTCTCGCCTACTTAAATTTGACTACACATCTAGTTCCACCCATCAGCATGCAATGTGACCACTGGTTAGAAATTACAGTATGTACGGTATGGCATTGCATCATCGATCTTTAGC
TGCCTCCAGTTTTTACCACTGTTGTCAGACTTTCTGAGAGATCGTGCGAAACTAGCTATTTTAATTTAGAGTCACTAGCTAGCTCTTTGGTCTTGCTCCTTGACAGCCAATAGAATTCCC
TAAAACACAACTCGTAGCCATACTACTTCAGTCGCCTGCAGAACACAATGAACAGTTTTGACACTTGAAACATATGCCCAACGCTTATTTTACACATTGGTATCCGTATGAAACTTAACA
AATATTTACTCCTTTGAAAATATGTATTTTTTTTAAAAAAAAAATTGGTTAGCACACAATCTCTATGAGCTAGATGGTTTTTAATACTCCCTCTGTCTCAAAATAAAATTCGTTCTACCC
TTTAGTTAATTCATACAATAATTGATGTATTTGTTTTATATGTGTGTTTTTTATAATCATCATCATCCAATTGAACAAAGACATACAAATCAAAAGCTGAAAACTAATATTCTAGAACGG
GTGGAGTATTAAATCACGTTATAAAAAATCATGTAACTACTTATTTTGATTTTCTTTATTATATGTATGTACATCTATGCTGGTCCAAAAAATAAAGTAAAAACACTTTTCTACTTGATC
CACGTGCAGGGTTGCGATGGGTCGGTGCTGCTGAATGACACGGCCACCTTCACCGGCGAGCAGACCGCTAATCCGAACGTCGGCTCCATCAGAGGCTTCGGCGTCGTCGACAACATCAAG
GCGCAGGTGGAGGCGGTGTGCCCGGGCGTCGTCTCCTGCGCCGACATCCTCGCCGTCGCCGCCCGCGACTCCGTCGTCGCG
GTAATAAGAAACGGACCCCGGACGGCCGGCCGGCGCGGC
CGTAGTTACACGGATCCTCAGCCTTTTAATTCCGTGTACGTACGTTCATATGTGTGCTCTGCTGTGCAGCTGGGAGGGCCTTCGTGGAGGGTGCTTCTCGGGCGGAGGGACTCGACGACG
GCGAGCCTAACTCTAGCCAACAGCGACCTGCCAGCGCCGTCCCTGGACCTCGCCAACCTCACCGCTGCGTTCGCCAAGAAGCGGCTCAGCAGGACCGACCTGGTCGCTCTCTCAGGCGCG
CACACGATCGGGCTGGCACAGTGCAAGAACTTCCGGGCGCACATATACAACGACACCAACGTGAACGCGGCGTTCGCGACGCTGCGCAGGGCCAACTGCCCCGCGGCGGCCGGCAACGGC
GACGGCAACCTGGCGCCGCTGGACACCGCCACGCCCACCGCGTTCGACAACGCCTACTACACCAACCTGCTGGCGCAGAGAGGGCTGCTACACTCCGACCAGCAGCTCTTCAACGGCGGC
GCCACGGACGGCCTGGTCCGCACGTACGCGTCCACGCCGAGGAGGTTCAGCGGGGACTTCGCGGCGGCCATGATCAGGATGGGCAACATCAGCCCGCTCACCGGGACGCAGGGCCAGATC
AGGCGCGCCTGTTCCAGGGTCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTCTTCTTTTACTTCCTTGTCAGTGATGGTGCTCTTGTGCCTAGCGGCGGCGGCGGTGGCCTCGGCGCAACTGTCGCCGACATTCTACTCCAGGTCGTGTCCCAGAGCTCTG
GCCACCATCAAGGCCGCCGTGACGGCCGCGGTTGCGCAGGAGGCTCGCATGGGGGCCTCCCTGCTCAGGCTCCACTTCCATGACTGCTTTGTCCAA
GGTTGCGATGGGTCGGTGCTGCTG
AATGACACGGCCACCTTCACCGGCGAGCAGACCGCTAATCCGAACGTCGGCTCCATCAGAGGCTTCGGCGTCGTCGACAACATCAAGGCGCAGGTGGAGGCGGTGTGCCCGGGCGTCGTC
TCCTGCGCCGACATCCTCGCCGTCGCCGCCCGCGACTCCGTCGTCGCG
CTGGGAGGGCCTTCGTGGAGGGTGCTTCTCGGGCGGAGGGACTCGACGACGGCGAGCCTAACTCTAGCCAAC
AGCGACCTGCCAGCGCCGTCCCTGGACCTCGCCAACCTCACCGCTGCGTTCGCCAAGAAGCGGCTCAGCAGGACCGACCTGGTCGCTCTCTCAGGCGCGCACACGATCGGGCTGGCACAG
TGCAAGAACTTCCGGGCGCACATATACAACGACACCAACGTGAACGCGGCGTTCGCGACGCTGCGCAGGGCCAACTGCCCCGCGGCGGCCGGCAACGGCGACGGCAACCTGGCGCCGCTG
GACACCGCCACGCCCACCGCGTTCGACAACGCCTACTACACCAACCTGCTGGCGCAGAGAGGGCTGCTACACTCCGACCAGCAGCTCTTCAACGGCGGCGCCACGGACGGCCTGGTCCGC
ACGTACGCGTCCACGCCGAGGAGGTTCAGCGGGGACTTCGCGGCGGCCATGATCAGGATGGGCAACATCAGCCCGCTCACCGGGACGCAGGGCCAGATCAGGCGCGCCTGTTCCAGGGTC
AACTAG

Retrieve as FASTA